BLASTX nr result
ID: Acanthopanax21_contig00020782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00020782 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013449476.1| histidine biosynthesis hisIE protein [Medica... 62 1e-08 ref|XP_013449477.1| histidine biosynthesis hisIE protein [Medica... 62 2e-08 ref|XP_013449475.1| histidine biosynthesis hisIE protein [Medica... 62 2e-08 ref|XP_018822019.1| PREDICTED: histidine biosynthesis bifunction... 59 1e-07 gb|PON96444.1| Phosphoribosyl-ATP pyrophosphohydrolase [Trema or... 60 1e-07 ref|XP_019263786.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 ref|XP_016460715.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 ref|XP_009804268.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 ref|XP_009613200.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 gb|PON43103.1| Phosphoribosyl-ATP pyrophosphohydrolase [Paraspon... 59 2e-07 ref|XP_018822018.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 ref|XP_018822017.1| PREDICTED: histidine biosynthesis bifunction... 59 2e-07 ref|XP_015165276.1| PREDICTED: histidine biosynthesis bifunction... 58 3e-07 ref|XP_019194020.1| PREDICTED: histidine biosynthesis bifunction... 59 3e-07 dbj|GAU17217.1| hypothetical protein TSUD_324200 [Trifolium subt... 59 3e-07 gb|PNY17699.1| histidine biosynthesis hisIE protein [Trifolium p... 59 3e-07 ref|XP_019427743.1| PREDICTED: histidine biosynthesis bifunction... 58 4e-07 ref|XP_015055596.1| PREDICTED: histidine biosynthesis bifunction... 58 5e-07 ref|XP_004248357.1| PREDICTED: histidine biosynthesis bifunction... 58 5e-07 gb|PHT33000.1| Histidine biosynthesis bifunctional protein hisIE... 58 5e-07 >ref|XP_013449476.1| histidine biosynthesis hisIE protein [Medicago truncatula] gb|KEH23504.1| histidine biosynthesis hisIE protein [Medicago truncatula] Length = 206 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQES 330 AMVLLAL++VKVEEVLQVLRQRFS+SGIEEK SR Q+S Sbjct: 165 AMVLLALKDVKVEEVLQVLRQRFSKSGIEEKRSRPTQKS 203 >ref|XP_013449477.1| histidine biosynthesis hisIE protein [Medicago truncatula] gb|KEH23505.1| histidine biosynthesis hisIE protein [Medicago truncatula] Length = 269 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQES 330 AMVLLAL++VKVEEVLQVLRQRFS+SGIEEK SR Q+S Sbjct: 228 AMVLLALKDVKVEEVLQVLRQRFSKSGIEEKRSRPTQKS 266 >ref|XP_013449475.1| histidine biosynthesis hisIE protein [Medicago truncatula] gb|KEH23503.1| histidine biosynthesis hisIE protein [Medicago truncatula] Length = 283 Score = 61.6 bits (148), Expect = 2e-08 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQES 330 AMVLLAL++VKVEEVLQVLRQRFS+SGIEEK SR Q+S Sbjct: 242 AMVLLALKDVKVEEVLQVLRQRFSKSGIEEKRSRPTQKS 280 >ref|XP_018822019.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic isoform X3 [Juglans regia] Length = 203 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/37 (72%), Positives = 36/37 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQ 336 AMVLLA+++VK+E+V+QVLRQRFSQSGIEEK SR+++ Sbjct: 166 AMVLLAVKDVKIEDVMQVLRQRFSQSGIEEKSSRRSE 202 >gb|PON96444.1| Phosphoribosyl-ATP pyrophosphohydrolase [Trema orientalis] Length = 283 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLLAL++VK+E+VLQVLRQRFSQSGIEEK SRK+ Sbjct: 246 AMVLLALKDVKMEDVLQVLRQRFSQSGIEEKRSRKS 281 >ref|XP_019263786.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana attenuata] gb|OIT36885.1| histidine biosynthesis bifunctional protein hisie, chloroplastic [Nicotiana attenuata] Length = 280 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEVLQVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKIEEVLQVLRQRFSKSGIEEKNSRKS 280 >ref|XP_016460715.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Nicotiana tabacum] Length = 280 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEVLQVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKIEEVLQVLRQRFSKSGIEEKNSRKS 280 >ref|XP_009804268.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana sylvestris] ref|XP_009804270.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana sylvestris] ref|XP_016434030.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Nicotiana tabacum] ref|XP_016434031.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Nicotiana tabacum] Length = 280 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEVLQVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKIEEVLQVLRQRFSKSGIEEKNSRKS 280 >ref|XP_009613200.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana tomentosiformis] ref|XP_018629753.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana tomentosiformis] ref|XP_018629754.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana tomentosiformis] ref|XP_018629755.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Nicotiana tomentosiformis] Length = 280 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEVLQVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKIEEVLQVLRQRFSKSGIEEKNSRKS 280 >gb|PON43103.1| Phosphoribosyl-ATP pyrophosphohydrolase [Parasponia andersonii] Length = 283 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRK 342 AMVLLAL++VK+E+VLQVLRQRFSQSGIEEK SRK Sbjct: 246 AMVLLALKDVKMEDVLQVLRQRFSQSGIEEKRSRK 280 >ref|XP_018822018.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic isoform X2 [Juglans regia] Length = 288 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 36/37 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQ 336 AMVLLA+++VK+E+V+QVLRQRFSQSGIEEK SR+++ Sbjct: 251 AMVLLAVKDVKIEDVMQVLRQRFSQSGIEEKSSRRSE 287 >ref|XP_018822017.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic isoform X1 [Juglans regia] Length = 290 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/37 (72%), Positives = 36/37 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQ 336 AMVLLA+++VK+E+V+QVLRQRFSQSGIEEK SR+++ Sbjct: 253 AMVLLAVKDVKIEDVMQVLRQRFSQSGIEEKSSRRSE 289 >ref|XP_015165276.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Solanum tuberosum] Length = 201 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEV+QVLRQRFS+SGIEEK SRK+ Sbjct: 166 AMVLLSLRGVKLEEVMQVLRQRFSKSGIEEKNSRKS 201 >ref|XP_019194020.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Ipomoea nil] Length = 276 Score = 58.5 bits (140), Expect = 3e-07 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLLA R VK+EEVLQVLRQRFSQSGIEEK SRK+ Sbjct: 241 AMVLLANRGVKIEEVLQVLRQRFSQSGIEEKKSRKS 276 >dbj|GAU17217.1| hypothetical protein TSUD_324200 [Trifolium subterraneum] Length = 301 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQES 330 AMVLLAL++VKVE+VLQVLRQRFS+SGIEEK SR +S Sbjct: 260 AMVLLALKDVKVEDVLQVLRQRFSKSGIEEKRSRATHKS 298 >gb|PNY17699.1| histidine biosynthesis hisIE protein [Trifolium pratense] Length = 303 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKAQES 330 AMVLLAL++VKVE+VLQVLRQRFS+SGIEEK SR +S Sbjct: 262 AMVLLALKDVKVEDVLQVLRQRFSKSGIEEKRSRTTHKS 300 >ref|XP_019427743.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Lupinus angustifolius] ref|XP_019427744.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Lupinus angustifolius] gb|OIV90481.1| hypothetical protein TanjilG_18665 [Lupinus angustifolius] Length = 283 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSR 345 AMVLLAL++VKVE+VLQ+LRQRFSQSGIEEK SR Sbjct: 242 AMVLLALKDVKVEDVLQILRQRFSQSGIEEKKSR 275 >ref|XP_015055596.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Solanum pennellii] Length = 280 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEV+QVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKLEEVMQVLRQRFSKSGIEEKNSRKS 280 >ref|XP_004248357.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Solanum lycopersicum] Length = 280 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEV+QVLRQRFS+SGIEEK SRK+ Sbjct: 245 AMVLLSLRGVKLEEVMQVLRQRFSKSGIEEKNSRKS 280 >gb|PHT33000.1| Histidine biosynthesis bifunctional protein hisIE, chloroplastic [Capsicum baccatum] Length = 281 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 446 AMVLLALREVKVEEVLQVLRQRFSQSGIEEKGSRKA 339 AMVLL+LR VK+EEV+QVLRQRFS+SGIEEK SRK+ Sbjct: 246 AMVLLSLRGVKLEEVMQVLRQRFSKSGIEEKNSRKS 281