BLASTX nr result
ID: Acanthopanax21_contig00020587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00020587 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthe... 78 6e-14 ref|XP_015059890.1| PREDICTED: indole-3-acetic acid-amido synthe... 78 6e-14 ref|XP_004251485.1| PREDICTED: indole-3-acetic acid-amido synthe... 78 6e-14 ref|XP_006363511.1| PREDICTED: indole-3-acetic acid-amido synthe... 78 6e-14 ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthe... 77 1e-13 ref|XP_015080346.1| PREDICTED: indole-3-acetic acid-amido synthe... 77 2e-13 ref|XP_022888388.1| indole-3-acetic acid-amido synthetase GH3.6-... 77 2e-13 ref|XP_022001455.1| indole-3-acetic acid-amido synthetase GH3.5-... 76 3e-13 ref|XP_021993185.1| indole-3-acetic acid-amido synthetase GH3.6 ... 76 3e-13 gb|PHU13127.1| Indole-3-acetic acid-amido synthetase GH3.6 [Caps... 76 4e-13 gb|PHT44260.1| Indole-3-acetic acid-amido synthetase GH3.6 [Caps... 76 4e-13 ref|XP_016581313.1| PREDICTED: indole-3-acetic acid-amido synthe... 76 4e-13 gb|KHN32940.1| Indole-3-acetic acid-amido synthetase GH3.5 [Glyc... 70 2e-12 ref|XP_019249800.1| PREDICTED: indole-3-acetic acid-amido synthe... 74 2e-12 ref|XP_009763610.1| PREDICTED: indole-3-acetic acid-amido synthe... 74 2e-12 ref|XP_009615928.1| PREDICTED: indole-3-acetic acid-amido synthe... 74 2e-12 emb|CBI20465.3| unnamed protein product, partial [Vitis vinifera] 74 2e-12 ref|XP_002533739.1| PREDICTED: indole-3-acetic acid-amido synthe... 74 2e-12 emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] 74 2e-12 ref|XP_021808490.1| indole-3-acetic acid-amido synthetase GH3.6 ... 74 2e-12 >ref|XP_004244168.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum lycopersicum] Length = 607 Score = 78.2 bits (191), Expect = 6e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 F PIVELLNSR+VSNYFSPKCPKW PGHKQWNNMN Sbjct: 573 FEPIVELLNSRVVSNYFSPKCPKWVPGHKQWNNMN 607 >ref|XP_015059890.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum pennellii] Length = 609 Score = 78.2 bits (191), Expect = 6e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNSR++S YFSPKCPKWTPGHKQWNNMN Sbjct: 575 FAPIIELLNSRVMSKYFSPKCPKWTPGHKQWNNMN 609 >ref|XP_004251485.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum lycopersicum] Length = 609 Score = 78.2 bits (191), Expect = 6e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNSR++S YFSPKCPKWTPGHKQWNNMN Sbjct: 575 FAPIIELLNSRVMSKYFSPKCPKWTPGHKQWNNMN 609 >ref|XP_006363511.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum tuberosum] Length = 614 Score = 78.2 bits (191), Expect = 6e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNSR++S YFSPKCPKWTPGHKQWNNMN Sbjct: 580 FAPIIELLNSRVMSKYFSPKCPKWTPGHKQWNNMN 614 >ref|XP_006360114.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Solanum tuberosum] Length = 607 Score = 77.0 bits (188), Expect = 1e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 F PIVELLNS++VSNYFSPKCPKW PGHKQWNNMN Sbjct: 573 FEPIVELLNSKVVSNYFSPKCPKWVPGHKQWNNMN 607 >ref|XP_015080346.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Solanum pennellii] Length = 607 Score = 76.6 bits (187), Expect = 2e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 F PIVELLNSR+VSNYFSPKCPKW PGHKQWNN+N Sbjct: 573 FEPIVELLNSRVVSNYFSPKCPKWVPGHKQWNNIN 607 >ref|XP_022888388.1| indole-3-acetic acid-amido synthetase GH3.6-like [Olea europaea var. sylvestris] Length = 613 Score = 76.6 bits (187), Expect = 2e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VS+ FSPKCPKWTPGHKQWNNMN Sbjct: 579 FAPIVELLNSRVVSSNFSPKCPKWTPGHKQWNNMN 613 >ref|XP_022001455.1| indole-3-acetic acid-amido synthetase GH3.5-like [Helianthus annuus] gb|OTG01939.1| putative GH3 family [Helianthus annuus] Length = 599 Score = 76.3 bits (186), Expect = 3e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNS +VSNYFSPKCPKW PGHKQWNNMN Sbjct: 565 FAPIIELLNSLVVSNYFSPKCPKWFPGHKQWNNMN 599 >ref|XP_021993185.1| indole-3-acetic acid-amido synthetase GH3.6 [Helianthus annuus] gb|OTG07589.1| putative auxin-responsive GH3 family protein [Helianthus annuus] Length = 616 Score = 76.3 bits (186), Expect = 3e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VSNYFSPKCPKW PGHKQW N+N Sbjct: 582 FAPIVELLNSRVVSNYFSPKCPKWVPGHKQWGNVN 616 >gb|PHU13127.1| Indole-3-acetic acid-amido synthetase GH3.6 [Capsicum chinense] Length = 612 Score = 75.9 bits (185), Expect = 4e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VSNYFSPKCPKW PG KQWNNMN Sbjct: 578 FAPIVELLNSRVVSNYFSPKCPKWVPGLKQWNNMN 612 >gb|PHT44260.1| Indole-3-acetic acid-amido synthetase GH3.6 [Capsicum baccatum] Length = 612 Score = 75.9 bits (185), Expect = 4e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VSNYFSPKCPKW PG KQWNNMN Sbjct: 578 FAPIVELLNSRVVSNYFSPKCPKWVPGLKQWNNMN 612 >ref|XP_016581313.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Capsicum annuum] gb|PHT77187.1| Indole-3-acetic acid-amido synthetase GH3.6 [Capsicum annuum] Length = 612 Score = 75.9 bits (185), Expect = 4e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VSNYFSPKCPKW PG KQWNNMN Sbjct: 578 FAPIVELLNSRVVSNYFSPKCPKWVPGLKQWNNMN 612 >gb|KHN32940.1| Indole-3-acetic acid-amido synthetase GH3.5 [Glycine soja] Length = 147 Score = 70.5 bits (171), Expect = 2e-12 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAP+VELLNSR+V YFSPKCPKW PGHKQW N N Sbjct: 113 FAPVVELLNSRVVEKYFSPKCPKWVPGHKQWINQN 147 >ref|XP_019249800.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nicotiana attenuata] gb|OIT00468.1| indole-3-acetic acid-amido synthetase gh3.6 [Nicotiana attenuata] Length = 609 Score = 73.9 bits (180), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VS+YFSPKCPKW PG KQWNNMN Sbjct: 575 FAPIVELLNSRVVSSYFSPKCPKWVPGLKQWNNMN 609 >ref|XP_009763610.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nicotiana sylvestris] ref|XP_016498541.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Nicotiana tabacum] Length = 609 Score = 73.9 bits (180), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VS+YFSPKCPKW PG KQWNNMN Sbjct: 575 FAPIVELLNSRVVSSYFSPKCPKWVPGLKQWNNMN 609 >ref|XP_009615928.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform X1 [Nicotiana tomentosiformis] ref|XP_009615930.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform X2 [Nicotiana tomentosiformis] ref|XP_009615931.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform X3 [Nicotiana tomentosiformis] ref|XP_016453588.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6-like [Nicotiana tabacum] Length = 609 Score = 73.9 bits (180), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VS+YFSPKCPKW PG KQWNNMN Sbjct: 575 FAPIVELLNSRVVSSYFSPKCPKWVPGLKQWNNMN 609 >emb|CBI20465.3| unnamed protein product, partial [Vitis vinifera] Length = 569 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNSR+VSNYFSPKCPKW PGHKQW N N Sbjct: 535 FAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNKN 569 >ref|XP_002533739.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 [Ricinus communis] gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VS+YFSPKCPKW PGHKQW N N Sbjct: 578 FAPIVELLNSRVVSSYFSPKCPKWVPGHKQWGNKN 612 >emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPI+ELLNSR+VSNYFSPKCPKW PGHKQW N N Sbjct: 579 FAPIIELLNSRVVSNYFSPKCPKWIPGHKQWCNKN 613 >ref|XP_021808490.1| indole-3-acetic acid-amido synthetase GH3.6 [Prunus avium] Length = 614 Score = 73.6 bits (179), Expect = 2e-12 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 436 FAPIVELLNSRIVSNYFSPKCPKWTPGHKQWNNMN 332 FAPIVELLNSR+VSNYFSPKCPKW PGHKQW N++ Sbjct: 580 FAPIVELLNSRVVSNYFSPKCPKWVPGHKQWCNLD 614