BLASTX nr result
ID: Acanthopanax21_contig00020142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00020142 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM95544.1| hypothetical protein DCAR_018786 [Daucus carota s... 65 9e-11 >gb|KZM95544.1| hypothetical protein DCAR_018786 [Daucus carota subsp. sativus] Length = 85 Score = 64.7 bits (156), Expect = 9e-11 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 480 KACMPKGRRHSSGPSRFVNFHIFDDLLGCETGRR 379 KACMPKGRRHSS PSR+VNFH FD LLGCE+ R+ Sbjct: 47 KACMPKGRRHSSAPSRYVNFHTFDGLLGCESSRK 80