BLASTX nr result
ID: Acanthopanax21_contig00019898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00019898 (626 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022861171.1| bifunctional riboflavin biosynthesis protein... 50 4e-08 gb|OVA20897.1| hypothetical protein BVC80_8905g17 [Macleaya cord... 49 5e-08 gb|PIN14713.1| Bifunctional GTP cyclohydrolase II/3,4-dihydroxy-... 50 9e-08 ref|XP_017227398.1| PREDICTED: bifunctional riboflavin biosynthe... 51 2e-07 gb|PIM98817.1| Bifunctional GTP cyclohydrolase II/3,4-dihydroxy-... 50 3e-07 ref|XP_017230779.1| PREDICTED: bifunctional riboflavin biosynthe... 50 4e-07 gb|KZN09114.1| hypothetical protein DCAR_001770 [Daucus carota s... 50 4e-07 dbj|GAV63262.1| GTP_cyclohydro2 domain-containing protein/DHBP_s... 49 5e-07 ref|XP_022858456.1| bifunctional riboflavin biosynthesis protein... 51 6e-07 ref|XP_010025415.1| PREDICTED: bifunctional riboflavin biosynthe... 46 7e-07 ref|XP_011092434.1| bifunctional riboflavin biosynthesis protein... 49 7e-07 ref|XP_002534102.1| PREDICTED: bifunctional riboflavin biosynthe... 46 7e-07 gb|PKA65870.1| Riboflavin biosynthesis protein ribBA, chloroplas... 49 7e-07 ref|XP_011022833.1| PREDICTED: bifunctional riboflavin biosynthe... 44 9e-07 ref|XP_010942615.1| PREDICTED: probable bifunctional riboflavin ... 47 9e-07 ref|XP_008805893.1| PREDICTED: probable bifunctional riboflavin ... 47 9e-07 ref|XP_019701369.1| PREDICTED: probable bifunctional riboflavin ... 47 9e-07 ref|XP_008805895.1| PREDICTED: probable bifunctional riboflavin ... 47 9e-07 ref|XP_011022835.1| PREDICTED: bifunctional riboflavin biosynthe... 44 9e-07 ref|XP_010942617.1| PREDICTED: probable bifunctional riboflavin ... 47 9e-07 >ref|XP_022861171.1| bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like [Olea europaea var. sylvestris] Length = 558 Score = 50.4 bits (119), Expect(2) = 4e-08 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 FFV +GTGIVCVSMK+EDLERLQLP M Sbjct: 177 FFVKHGTGIVCVSMKEEDLERLQLPLM 203 Score = 35.0 bits (79), Expect(2) = 4e-08 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 V+HK NEEKLCTAFTVS Sbjct: 204 VSHKENEEKLCTAFTVS 220 >gb|OVA20897.1| hypothetical protein BVC80_8905g17 [Macleaya cordata] Length = 564 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 460 DYGFFVNNGTGIVCVSMKDEDLERLQLPQM 549 D F V +GTGIVCVSMK EDLERLQLP M Sbjct: 179 DAAFIVKHGTGIVCVSMKGEDLERLQLPLM 208 Score = 36.6 bits (83), Expect(2) = 5e-08 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKLCTAFTVS Sbjct: 209 VTHKENEEKLCTAFTVS 225 >gb|PIN14713.1| Bifunctional GTP cyclohydrolase II/3,4-dihydroxy-2butanone-4-phosphate synthase [Handroanthus impetiginosus] Length = 490 Score = 49.7 bits (117), Expect(2) = 9e-08 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 FFV +GTGIVCVSMK EDLERLQLP M Sbjct: 169 FFVKHGTGIVCVSMKSEDLERLQLPLM 195 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 V HK NEEKLCTAFTVS Sbjct: 196 VNHKENEEKLCTAFTVS 212 >ref|XP_017227398.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like [Daucus carota subsp. sativus] gb|KZM81580.1| hypothetical protein DCAR_029193 [Daucus carota subsp. sativus] Length = 552 Score = 50.8 bits (120), Expect(2) = 2e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK+EDLERLQLPQM Sbjct: 173 FIVKHGTGIVCVSMKEEDLERLQLPQM 199 Score = 32.3 bits (72), Expect(2) = 2e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKL TAFTVS Sbjct: 200 VTHKDNEEKLTTAFTVS 216 >gb|PIM98817.1| Bifunctional GTP cyclohydrolase II/3,4-dihydroxy-2butanone-4-phosphate synthase [Handroanthus impetiginosus] Length = 549 Score = 50.4 bits (119), Expect(2) = 3e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 FFV +GTGIVCVSMK+EDLERLQLP M Sbjct: 169 FFVKHGTGIVCVSMKEEDLERLQLPLM 195 Score = 32.0 bits (71), Expect(2) = 3e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKL TAFTVS Sbjct: 196 VTHKENEEKLRTAFTVS 212 >ref|XP_017230779.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic [Daucus carota subsp. sativus] Length = 553 Score = 49.7 bits (117), Expect(2) = 4e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK++DLERLQLPQM Sbjct: 174 FIVKHGTGIVCVSMKEQDLERLQLPQM 200 Score = 32.3 bits (72), Expect(2) = 4e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKL TAFTVS Sbjct: 201 VTHKDNEEKLTTAFTVS 217 >gb|KZN09114.1| hypothetical protein DCAR_001770 [Daucus carota subsp. sativus] Length = 539 Score = 49.7 bits (117), Expect(2) = 4e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK++DLERLQLPQM Sbjct: 160 FIVKHGTGIVCVSMKEQDLERLQLPQM 186 Score = 32.3 bits (72), Expect(2) = 4e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKL TAFTVS Sbjct: 187 VTHKDNEEKLTTAFTVS 203 >dbj|GAV63262.1| GTP_cyclohydro2 domain-containing protein/DHBP_synthase domain-containing protein [Cephalotus follicularis] Length = 590 Score = 49.3 bits (116), Expect(2) = 5e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM*PIK 561 F V +GTGIVCVSMKDEDLERL+LP M +K Sbjct: 208 FIVKHGTGIVCVSMKDEDLERLELPLMVTLK 238 Score = 32.3 bits (72), Expect(2) = 5e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT K NEEKLCTAFTVS Sbjct: 235 VTLKENEEKLCTAFTVS 251 >ref|XP_022858456.1| bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like [Olea europaea var. sylvestris] Length = 329 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM*PIK 561 FFV +GTGIVCVSMK+EDLERLQLP M +K Sbjct: 177 FFVKHGTGIVCVSMKEEDLERLQLPLMVSLK 207 Score = 30.4 bits (67), Expect(2) = 6e-07 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 V+ K NEEKLCTAFT+S Sbjct: 204 VSLKENEEKLCTAFTIS 220 >ref|XP_010025415.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic [Eucalyptus grandis] gb|KCW62071.1| hypothetical protein EUGRSUZ_H04741 [Eucalyptus grandis] Length = 540 Score = 45.8 bits (107), Expect(2) = 7e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V GTGIVCVSM++EDLERLQLP M Sbjct: 172 FIVKYGTGIVCVSMREEDLERLQLPLM 198 Score = 35.4 bits (80), Expect(2) = 7e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK N+EKLCTAFTVS Sbjct: 199 VTHKENQEKLCTAFTVS 215 >ref|XP_011092434.1| bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic [Sesamum indicum] Length = 531 Score = 49.3 bits (116), Expect(2) = 7e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 FFV +GTGIVCVSMK EDLERLQLP M Sbjct: 166 FFVKHGTGIVCVSMKGEDLERLQLPLM 192 Score = 32.0 bits (71), Expect(2) = 7e-07 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 V+ K NEEKLCTAFTVS Sbjct: 193 VSQKENEEKLCTAFTVS 209 >ref|XP_002534102.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic [Ricinus communis] gb|EEF28284.1| GTP cyclohydrolase II, putative [Ricinus communis] Length = 531 Score = 45.8 bits (107), Expect(2) = 7e-07 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDLERL+LP M Sbjct: 177 FIVKHGTGIVCVSMKGEDLERLELPLM 203 Score = 35.4 bits (80), Expect(2) = 7e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKLCTAFTV+ Sbjct: 204 VTHKENEEKLCTAFTVT 220 >gb|PKA65870.1| Riboflavin biosynthesis protein ribBA, chloroplastic [Apostasia shenzhenica] Length = 522 Score = 48.5 bits (114), Expect(2) = 7e-07 Identities = 22/27 (81%), Positives = 24/27 (88%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDL+RLQLPQM Sbjct: 150 FIVRHGTGIVCVSMKGEDLDRLQLPQM 176 Score = 32.7 bits (73), Expect(2) = 7e-07 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 V H+ NEEKLCTAFTVS Sbjct: 177 VMHRDNEEKLCTAFTVS 193 >ref|XP_011022833.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like isoform X1 [Populus euphratica] ref|XP_011022834.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like isoform X1 [Populus euphratica] Length = 558 Score = 44.3 bits (103), Expect(2) = 9e-07 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDL+RL+LP M Sbjct: 175 FIVKHGTGIVCVSMKAEDLDRLELPLM 201 Score = 36.6 bits (83), Expect(2) = 9e-07 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKLCTAFTVS Sbjct: 202 VTHKENEEKLCTAFTVS 218 >ref|XP_010942615.1| PREDICTED: probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X1 [Elaeis guineensis] Length = 552 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDLERLQLP M Sbjct: 174 FIVRHGTGIVCVSMKGEDLERLQLPLM 200 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT+K NEEKLCTAFTVS Sbjct: 201 VTNKENEEKLCTAFTVS 217 >ref|XP_008805893.1| PREDICTED: probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X1 [Phoenix dactylifera] Length = 552 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK+EDLE+LQLP M Sbjct: 174 FIVRHGTGIVCVSMKEEDLEKLQLPLM 200 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT+K NEEKLCTAFTVS Sbjct: 201 VTNKENEEKLCTAFTVS 217 >ref|XP_019701369.1| PREDICTED: probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X2 [Elaeis guineensis] Length = 549 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDLERLQLP M Sbjct: 171 FIVRHGTGIVCVSMKGEDLERLQLPLM 197 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT+K NEEKLCTAFTVS Sbjct: 198 VTNKENEEKLCTAFTVS 214 >ref|XP_008805895.1| PREDICTED: probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X2 [Phoenix dactylifera] Length = 549 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK+EDLE+LQLP M Sbjct: 171 FIVRHGTGIVCVSMKEEDLEKLQLPLM 197 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT+K NEEKLCTAFTVS Sbjct: 198 VTNKENEEKLCTAFTVS 214 >ref|XP_011022835.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like isoform X2 [Populus euphratica] ref|XP_011022836.1| PREDICTED: bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic-like isoform X2 [Populus euphratica] Length = 526 Score = 44.3 bits (103), Expect(2) = 9e-07 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDL+RL+LP M Sbjct: 143 FIVKHGTGIVCVSMKAEDLDRLELPLM 169 Score = 36.6 bits (83), Expect(2) = 9e-07 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VTHK NEEKLCTAFTVS Sbjct: 170 VTHKENEEKLCTAFTVS 186 >ref|XP_010942617.1| PREDICTED: probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X3 [Elaeis guineensis] Length = 478 Score = 47.0 bits (110), Expect(2) = 9e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 469 FFVNNGTGIVCVSMKDEDLERLQLPQM 549 F V +GTGIVCVSMK EDLERLQLP M Sbjct: 100 FIVRHGTGIVCVSMKGEDLERLQLPLM 126 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 549 VTHKANEEKLCTAFTVS 599 VT+K NEEKLCTAFTVS Sbjct: 127 VTNKENEEKLCTAFTVS 143