BLASTX nr result
ID: Acanthopanax21_contig00019700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00019700 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017259113.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 70 3e-11 ref|XP_016574940.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b... 67 3e-10 gb|PIN24012.1| DM13, DoH, and DOMON domain protein [Handroanthus... 67 3e-10 gb|PHU14851.1| Cytochrome, and DOMON domain-containing protein [... 67 3e-10 gb|PHT79083.1| Cytochrome, and DOMON domain-containing protein [... 67 3e-10 gb|PHT45767.1| Cytochrome, and DOMON domain-containing protein [... 67 3e-10 ref|XP_019247906.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 66 6e-10 ref|XP_016508235.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 66 6e-10 ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 66 6e-10 ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 66 6e-10 emb|CDP00314.1| unnamed protein product [Coffea canephora] 64 5e-09 ref|XP_019180391.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 62 2e-08 ref|XP_019180390.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 62 2e-08 ref|XP_022892673.1| cytochrome b561, DM13 and DOMON domain-conta... 60 8e-08 ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 60 8e-08 ref|XP_015080218.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 59 3e-07 gb|KMT19028.1| hypothetical protein BVRB_2g031230 [Beta vulgaris... 57 1e-06 ref|XP_006353660.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 1e-06 ref|XP_010665962.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 1e-06 ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 56 2e-06 >ref|XP_017259113.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Daucus carota subsp. sativus] gb|KZM89789.1| hypothetical protein DCAR_022848 [Daucus carota subsp. sativus] Length = 891 Score = 70.1 bits (170), Expect = 3e-11 Identities = 36/51 (70%), Positives = 37/51 (72%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRR+ RSNWVLGNG LSPS M VDKDLH SDRMEVQLEPLNR Sbjct: 841 RRRESFLARSNWVLGNGEDEDHDLLSPSGMSVDKDLHPSDRMEVQLEPLNR 891 >ref|XP_016574940.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Capsicum annuum] Length = 883 Score = 67.0 bits (162), Expect = 3e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDRLSGRSNWVLG+G LSPS++ DKD SDRMEVQLEP++R Sbjct: 833 RRRDRLSGRSNWVLGSGEEEDIDLLSPSQVRADKDSGSSDRMEVQLEPISR 883 >gb|PIN24012.1| DM13, DoH, and DOMON domain protein [Handroanthus impetiginosus] Length = 884 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRR R+SGRSNWVLGNG LSPS+M+ DK+ S+RMEVQLEPL+R Sbjct: 834 RRRGRISGRSNWVLGNGEEEDIDLLSPSQMMTDKESQSSERMEVQLEPLSR 884 >gb|PHU14851.1| Cytochrome, and DOMON domain-containing protein [Capsicum chinense] Length = 896 Score = 67.0 bits (162), Expect = 3e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDRLSGRSNWVLG+G LSPS++ DKD SDRMEVQLEP++R Sbjct: 846 RRRDRLSGRSNWVLGSGEEEDIDLLSPSQVRADKDSGSSDRMEVQLEPISR 896 >gb|PHT79083.1| Cytochrome, and DOMON domain-containing protein [Capsicum annuum] Length = 896 Score = 67.0 bits (162), Expect = 3e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDRLSGRSNWVLG+G LSPS++ DKD SDRMEVQLEP++R Sbjct: 846 RRRDRLSGRSNWVLGSGEEEDIDLLSPSQVRADKDSGSSDRMEVQLEPISR 896 >gb|PHT45767.1| Cytochrome, and DOMON domain-containing protein [Capsicum baccatum] Length = 896 Score = 67.0 bits (162), Expect = 3e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDRLSGRSNWVLG+G LSPS++ DKD SDRMEVQLEP++R Sbjct: 846 RRRDRLSGRSNWVLGSGEEEDIDLLSPSQVRADKDSGSSDRMEVQLEPISR 896 >ref|XP_019247906.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana attenuata] gb|OIT02583.1| cytochrome b561, dm13 and domon domain-containing protein [Nicotiana attenuata] Length = 900 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR+SGRSNWVLG+G LSPS+ + +KD SDRMEVQLEP++R Sbjct: 850 RRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 900 >ref|XP_016508235.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Nicotiana tabacum] Length = 900 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR+SGRSNWVLG+G LSPS+ + +KD SDRMEVQLEP++R Sbjct: 850 RRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 900 >ref|XP_009799908.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana sylvestris] ref|XP_016468217.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Nicotiana tabacum] Length = 900 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR+SGRSNWVLG+G LSPS+ + +KD SDRMEVQLEP++R Sbjct: 850 RRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 900 >ref|XP_009594133.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nicotiana tomentosiformis] Length = 901 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR+SGRSNWVLG+G LSPS+ + +KD SDRMEVQLEP++R Sbjct: 851 RRRDRISGRSNWVLGSGEEEDIDLLSPSQAMAEKDSRSSDRMEVQLEPISR 901 >emb|CDP00314.1| unnamed protein product [Coffea canephora] Length = 844 Score = 63.5 bits (153), Expect = 5e-09 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RR+DR+SG S+WVLGNG LSPSR + +KD S+RMEVQLEPL+R Sbjct: 794 RRQDRISGGSSWVLGNGEEEDVDLLSPSRTVAEKDSDFSERMEVQLEPLSR 844 >ref|XP_019180391.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X2 [Ipomoea nil] Length = 918 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR RSNWVLGNG LSPSR VDKDL S+RMEVQLEPL R Sbjct: 869 RRRDREFARSNWVLGNGEEDDVDLLSPSR-AVDKDLQGSERMEVQLEPLKR 918 >ref|XP_019180390.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X1 [Ipomoea nil] Length = 1063 Score = 62.0 bits (149), Expect = 2e-08 Identities = 35/51 (68%), Positives = 36/51 (70%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRRDR RSNWVLGNG LSPSR VDKDL S+RMEVQLEPL R Sbjct: 1014 RRRDREFARSNWVLGNGEEDDVDLLSPSR-AVDKDLQGSERMEVQLEPLKR 1063 >ref|XP_022892673.1| cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Olea europaea var. sylvestris] Length = 894 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -3 Query: 396 RRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 RRDRLSGRS+WV+GNG L PSR + +K+ S+RME+QLEPL+R Sbjct: 845 RRDRLSGRSDWVMGNGEEDDIGLLRPSRPMAEKEALSSERMEIQLEPLSR 894 >ref|XP_010322736.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum lycopersicum] Length = 901 Score = 60.1 bits (144), Expect = 8e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 +RRDR+SGRSNWVLG+G LSPS+ + +KD +D MEVQLEP+ R Sbjct: 851 KRRDRISGRSNWVLGSGEEEDTDLLSPSQAMAEKDAASADCMEVQLEPMGR 901 >ref|XP_015080218.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum pennellii] Length = 901 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 +RRDR+SGRSNWVLG+G LSPS+ + +K+ +D MEVQLEP+ R Sbjct: 851 KRRDRISGRSNWVLGSGEEEDTDLLSPSQAMAEKEAASADCMEVQLEPMGR 901 >gb|KMT19028.1| hypothetical protein BVRB_2g031230 [Beta vulgaris subsp. vulgaris] Length = 860 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 390 DRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 DR SGR WVLGN LSP+ +K+ H+SDRMEVQLEPLNR Sbjct: 813 DRSSGRGKWVLGNEEDDTADLLSPTGTYAEKEAHLSDRMEVQLEPLNR 860 >ref|XP_006353660.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Solanum tuberosum] Length = 900 Score = 56.6 bits (135), Expect = 1e-06 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = -3 Query: 399 RRRDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 +RRDR+SGRSNWVLG+G LSPS+ + +KD SD MEVQLEP+ R Sbjct: 851 KRRDRISGRSNWVLGSG-EEDTDLLSPSQAMAEKDSGSSDCMEVQLEPMGR 900 >ref|XP_010665962.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Beta vulgaris subsp. vulgaris] Length = 908 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 390 DRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 DR SGR WVLGN LSP+ +K+ H+SDRMEVQLEPLNR Sbjct: 861 DRSSGRGKWVLGNEEDDTADLLSPTGTYAEKEAHLSDRMEVQLEPLNR 908 >ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Erythranthe guttata] gb|EYU32377.1| hypothetical protein MIMGU_mgv1a001118mg [Erythranthe guttata] Length = 883 Score = 56.2 bits (134), Expect = 2e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -3 Query: 393 RDRLSGRSNWVLGNGXXXXXXXLSPSRMIVDKDLHVSDRMEVQLEPLNR 247 R R++GRSNWVLGNG L SR + DK+ + S+RMEVQLEPL+R Sbjct: 835 RGRVAGRSNWVLGNGEEEDIDLLRQSRPMTDKESYSSERMEVQLEPLSR 883