BLASTX nr result
ID: Acanthopanax21_contig00019670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00019670 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017249418.1| PREDICTED: uncharacterized protein LOC108220... 58 1e-06 ref|XP_017249417.1| PREDICTED: uncharacterized protein LOC108220... 58 1e-06 >ref|XP_017249418.1| PREDICTED: uncharacterized protein LOC108220222 isoform X2 [Daucus carota subsp. sativus] gb|KZM95842.1| hypothetical protein DCAR_019084 [Daucus carota subsp. sativus] Length = 267 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -1 Query: 544 VNDQLSSLSENFDAFRADQEAKLEEWLKGTSDQNSHIGETNAEGL 410 ++ L SLS++FD F+A++EAKLE+WL+ TSDQ+ +GETNAE L Sbjct: 223 LSTNLLSLSKSFDEFKAEREAKLEQWLQQTSDQDDQLGETNAEKL 267 >ref|XP_017249417.1| PREDICTED: uncharacterized protein LOC108220222 isoform X1 [Daucus carota subsp. sativus] Length = 277 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -1 Query: 544 VNDQLSSLSENFDAFRADQEAKLEEWLKGTSDQNSHIGETNAEGL 410 ++ L SLS++FD F+A++EAKLE+WL+ TSDQ+ +GETNAE L Sbjct: 233 LSTNLLSLSKSFDEFKAEREAKLEQWLQQTSDQDDQLGETNAEKL 277