BLASTX nr result
ID: Acanthopanax21_contig00019451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00019451 (672 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH65189.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal ... 59 1e-06 >gb|KVH65189.1| DNA/RNA helicase, DEAD/DEAH box type, N-terminal [Cynara cardunculus var. scolymus] Length = 506 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 670 LSKEIRPVCKKFMRDVISHGQLYLNFEVTI 581 LSKEIRPVCKKFM+DVISHGQ YLNFEV I Sbjct: 242 LSKEIRPVCKKFMQDVISHGQFYLNFEVNI 271