BLASTX nr result
ID: Acanthopanax21_contig00018289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00018289 (730 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021838584.1| uncharacterized protein LOC110778326 [Spinac... 42 3e-07 >ref|XP_021838584.1| uncharacterized protein LOC110778326 [Spinacia oleracea] Length = 1082 Score = 42.4 bits (98), Expect(3) = 3e-07 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 5/43 (11%) Frame = +1 Query: 175 KKLWSLKIPPKVRHFLWRAFCQSVGIYRGL-----QVMVECPR 288 KKLW L+IPPKVR FLWRA +++ GL + CPR Sbjct: 759 KKLWGLQIPPKVRSFLWRACSKALPTCVGLNRRVTSIETTCPR 801 Score = 32.3 bits (72), Expect(3) = 3e-07 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 293 CGFERETIFHALISCPAAIATW 358 CG E FHAL+ CP A+ W Sbjct: 802 CGDNEENTFHALVKCPTAMEVW 823 Score = 27.3 bits (59), Expect(3) = 3e-07 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = +3 Query: 60 HVWHYSANGSF*SVWLCKE-----NKVSRASIGEPSS-ACTSLWKKV 182 + W+YS NG ++ K + R GEPSS A T LWKK+ Sbjct: 719 YAWYYSKNG----IYSVKSGYHFISYYKRVLNGEPSSSATTELWKKL 761