BLASTX nr result
ID: Acanthopanax21_contig00017734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00017734 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017235064.1| PREDICTED: putative E3 ubiquitin-protein lig... 64 7e-09 ref|XP_021894551.1| putative E3 ubiquitin-protein ligase XBAT31 ... 56 6e-06 >ref|XP_017235064.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT31 [Daucus carota subsp. sativus] gb|KZN04485.1| hypothetical protein DCAR_005322 [Daucus carota subsp. sativus] Length = 445 Score = 64.3 bits (155), Expect = 7e-09 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = +3 Query: 57 NPKDLTSSNPRKSRRFCNYXXXXXXXXXXXXXXXFGRMGARGSGRVAAENEWVDKP 224 +PKDL SN RKSRRF NY FGRM A GSGRVAA+NEW+DKP Sbjct: 390 DPKDLAFSNSRKSRRFRNYSEGSSSYKSLSTVGSFGRMSALGSGRVAADNEWLDKP 445 >ref|XP_021894551.1| putative E3 ubiquitin-protein ligase XBAT31 [Carica papaya] Length = 444 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/53 (50%), Positives = 32/53 (60%) Frame = +3 Query: 66 DLTSSNPRKSRRFCNYXXXXXXXXXXXXXXXFGRMGARGSGRVAAENEWVDKP 224 D TSS RKSR+ N+ FG+MG RGSGR+AA+NEWVDKP Sbjct: 392 DNTSSKARKSRKSRNFSEGSSSFKGLSAVGSFGKMGGRGSGRIAADNEWVDKP 444