BLASTX nr result
ID: Acanthopanax21_contig00016472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00016472 (663 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021746145.1| calcineurin subunit B-like [Chenopodium quinoa] 61 1e-08 ref|XP_021804075.1| calcineurin subunit B-like [Prunus avium] >g... 60 4e-08 emb|CDY17224.1| BnaA05g09640D [Brassica napus] 61 4e-08 ref|XP_019159899.1| PREDICTED: calcineurin subunit B-like isofor... 61 5e-08 ref|XP_019159898.1| PREDICTED: calcineurin subunit B-like isofor... 61 6e-08 ref|XP_019159896.1| PREDICTED: calcineurin subunit B-like isofor... 61 6e-08 ref|XP_017249845.1| PREDICTED: calcineurin subunit B-like [Daucu... 61 6e-08 ref|XP_019169974.1| PREDICTED: calcineurin subunit B-like [Ipomo... 60 9e-08 gb|OVA02470.1| EF-hand domain [Macleaya cordata] 59 1e-07 ref|XP_009143804.1| PREDICTED: calcineurin subunit B-like [Brass... 60 2e-07 ref|XP_013630906.1| PREDICTED: calcineurin subunit B-like [Brass... 60 2e-07 ref|NP_001336718.1| EF-hand, calcium binding motif-containing pr... 58 2e-07 gb|OAY69383.1| Calcineurin subunit B [Ananas comosus] 60 2e-07 ref|XP_018434315.1| PREDICTED: calcineurin subunit B-like isofor... 59 2e-07 gb|KRH09707.1| hypothetical protein GLYMA_15G006300 [Glycine max] 58 2e-07 gb|KRH09709.1| hypothetical protein GLYMA_15G006300 [Glycine max] 58 3e-07 ref|XP_019227014.1| PREDICTED: calcineurin subunit B-like [Nicot... 59 3e-07 ref|XP_018459896.1| PREDICTED: calcineurin subunit B-like [Rapha... 59 3e-07 ref|XP_018481269.1| PREDICTED: calcineurin subunit B-like [Rapha... 59 3e-07 ref|XP_013632270.1| PREDICTED: calcineurin subunit B-like [Brass... 59 3e-07 >ref|XP_021746145.1| calcineurin subunit B-like [Chenopodium quinoa] Length = 104 Score = 61.2 bits (147), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYS 105 LLKMVDGLNFKDFVAFLSAFSAKAS++QK RK+S Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASIEQKATRKFS 101 >ref|XP_021804075.1| calcineurin subunit B-like [Prunus avium] ref|XP_021804076.1| calcineurin subunit B-like [Prunus avium] Length = 109 Score = 59.7 bits (143), Expect = 4e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYS 105 LLKMVDGLNFKDFVAFLSAFSA+AS +QK ERK S Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSARASTQQKSERKLS 101 >emb|CDY17224.1| BnaA05g09640D [Brassica napus] Length = 175 Score = 61.2 bits (147), Expect = 4e-08 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYSGLQLYRHNLRGR 141 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK+E + Q+Y + G+ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVELIF---QVYDSDCNGK 110 >ref|XP_019159899.1| PREDICTED: calcineurin subunit B-like isoform X3 [Ipomoea nil] Length = 162 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKASM+QKIE Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASMRQKIE 97 >ref|XP_019159898.1| PREDICTED: calcineurin subunit B-like isoform X2 [Ipomoea nil] Length = 173 Score = 60.8 bits (146), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKASM+QKIE Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASMRQKIE 97 >ref|XP_019159896.1| PREDICTED: calcineurin subunit B-like isoform X1 [Ipomoea nil] ref|XP_019159897.1| PREDICTED: calcineurin subunit B-like isoform X1 [Ipomoea nil] Length = 175 Score = 60.8 bits (146), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKASM+QKIE Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASMRQKIE 97 >ref|XP_017249845.1| PREDICTED: calcineurin subunit B-like [Daucus carota subsp. sativus] gb|KZM93032.1| hypothetical protein DCAR_016277 [Daucus carota subsp. sativus] Length = 175 Score = 60.8 bits (146), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 L+KMVDGLNFKDFVAFLSAFSAKASMKQKIE Sbjct: 67 LVKMVDGLNFKDFVAFLSAFSAKASMKQKIE 97 >ref|XP_019169974.1| PREDICTED: calcineurin subunit B-like [Ipomoea nil] ref|XP_019169975.1| PREDICTED: calcineurin subunit B-like [Ipomoea nil] Length = 175 Score = 60.5 bits (145), Expect = 9e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKASM+QKIE Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASMQQKIE 97 >gb|OVA02470.1| EF-hand domain [Macleaya cordata] Length = 116 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS +QKIE Sbjct: 46 LLKMVDGLNFKDFVAFLSAFSAKASFRQKIE 76 >ref|XP_009143804.1| PREDICTED: calcineurin subunit B-like [Brassica rapa] ref|XP_018514907.1| PREDICTED: calcineurin subunit B-like [Brassica rapa] ref|XP_022574973.1| calcineurin subunit B-like [Brassica napus] ref|XP_022574974.1| calcineurin subunit B-like [Brassica napus] Length = 175 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYSGLQLYRHNLRGR 141 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK++ + Q+Y + G+ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVKLIF---QVYDSDCNGK 110 >ref|XP_013630906.1| PREDICTED: calcineurin subunit B-like [Brassica oleracea var. oleracea] ref|XP_013630907.1| PREDICTED: calcineurin subunit B-like [Brassica oleracea var. oleracea] ref|XP_013748550.1| calcineurin subunit B [Brassica napus] ref|XP_013748551.1| calcineurin subunit B [Brassica napus] emb|CDY63144.1| BnaCnng41460D [Brassica napus] Length = 175 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYSGLQLYRHNLRGR 141 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK++ + Q+Y + G+ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVKLIF---QVYDSDCNGK 110 >ref|NP_001336718.1| EF-hand, calcium binding motif-containing protein isoform 2 [Glycine max] gb|KRH09705.1| hypothetical protein GLYMA_15G006300 [Glycine max] gb|KRH09706.1| hypothetical protein GLYMA_15G006300 [Glycine max] Length = 116 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS +QKIE Sbjct: 8 LLKMVDGLNFKDFVAFLSAFSAKASAQQKIE 38 >gb|OAY69383.1| Calcineurin subunit B [Ananas comosus] Length = 187 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERK 99 LLKMVDGLNFKDFVAFLSAFSAKAS++ KIER+ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLQHKIERE 99 >ref|XP_018434315.1| PREDICTED: calcineurin subunit B-like isoform X2 [Raphanus sativus] Length = 141 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIERKYSGLQLYRHNLRGR 141 LLKMVDGLNFKDFVAFLSAFSAKAS++QK++ + Q+Y + G+ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLRQKVKLIF---QVYDSDCNGK 110 >gb|KRH09707.1| hypothetical protein GLYMA_15G006300 [Glycine max] Length = 127 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS +QKIE Sbjct: 19 LLKMVDGLNFKDFVAFLSAFSAKASAQQKIE 49 >gb|KRH09709.1| hypothetical protein GLYMA_15G006300 [Glycine max] Length = 129 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS +QKIE Sbjct: 8 LLKMVDGLNFKDFVAFLSAFSAKASAQQKIE 38 >ref|XP_019227014.1| PREDICTED: calcineurin subunit B-like [Nicotiana attenuata] gb|OIT31682.1| hypothetical protein A4A49_14474 [Nicotiana attenuata] Length = 175 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLS FSAKASM+QKIE Sbjct: 67 LLKMVDGLNFKDFVAFLSTFSAKASMQQKIE 97 >ref|XP_018459896.1| PREDICTED: calcineurin subunit B-like [Raphanus sativus] Length = 175 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK++ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVK 97 >ref|XP_018481269.1| PREDICTED: calcineurin subunit B-like [Raphanus sativus] ref|XP_018481270.1| PREDICTED: calcineurin subunit B-like [Raphanus sativus] Length = 175 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK++ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVK 97 >ref|XP_013632270.1| PREDICTED: calcineurin subunit B-like [Brassica oleracea var. oleracea] ref|XP_022558409.1| calcineurin subunit B-like [Brassica napus] Length = 175 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 LLKMVDGLNFKDFVAFLSAFSAKASMKQKIE 93 LLKMVDGLNFKDFVAFLSAFSAKAS+KQK++ Sbjct: 67 LLKMVDGLNFKDFVAFLSAFSAKASLKQKVK 97