BLASTX nr result
ID: Acanthopanax21_contig00016219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00016219 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001291227.1| CBL-interacting serine/threonine-protein kin... 56 5e-06 >ref|NP_001291227.1| CBL-interacting serine/threonine-protein kinase 24-like [Populus euphratica] gb|ACN76477.1| CBL-interacting protein kinase 27 [Populus euphratica] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -2 Query: 181 EGSYTFV-LSTSRSTPKSIDVIKYTDEEYKKF-LIDPIKREISIMKRVRHPNVVRLHEVL 8 EG++ V + +R T +S+D+ + K L+D IKREISIMK VRHPN+VRLHEVL Sbjct: 20 EGNFAKVKFAQNRETGESVDMNIFAKSTILKHKLVDQIKREISIMKIVRHPNIVRLHEVL 79 Query: 7 AS 2 +S Sbjct: 80 SS 81