BLASTX nr result
ID: Acanthopanax21_contig00015972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00015972 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019198649.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 70 4e-11 gb|PHU15025.1| Glycylpeptide N-tetradecanoyltransferase 2 [Capsi... 70 6e-11 ref|XP_016578562.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 70 6e-11 ref|XP_017253901.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 70 6e-11 gb|PHT45874.1| Glycylpeptide N-tetradecanoyltransferase 2 [Capsi... 69 8e-11 ref|XP_017254824.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 69 1e-10 ref|XP_015080217.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 68 2e-10 ref|XP_006357393.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 68 2e-10 ref|XP_004241898.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 68 2e-10 ref|XP_020209922.1| glycylpeptide N-tetradecanoyltransferase 1-l... 66 2e-10 ref|XP_011072547.1| glycylpeptide N-tetradecanoyltransferase 1-l... 68 3e-10 gb|KYP78184.1| Glycylpeptide N-tetradecanoyltransferase 1, parti... 66 3e-10 gb|PIN20658.1| N-myristoyl transferase [Handroanthus impetiginosus] 67 4e-10 gb|KVI10323.1| Acyl-CoA N-acyltransferase [Cynara cardunculus va... 67 4e-10 ref|XP_022013339.1| glycylpeptide N-tetradecanoyltransferase 1-l... 66 1e-09 ref|XP_022844650.1| glycylpeptide N-tetradecanoyltransferase 1-l... 66 1e-09 gb|OTF96449.1| putative glycylpeptide N-tetradecanoyltransferase... 66 1e-09 ref|XP_004505619.1| PREDICTED: glycylpeptide N-tetradecanoyltran... 66 1e-09 ref|XP_022844648.1| glycylpeptide N-tetradecanoyltransferase 1-l... 66 1e-09 gb|KYP63635.1| Glycylpeptide N-tetradecanoyltransferase 1 [Cajan... 66 1e-09 >ref|XP_019198649.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Ipomoea nil] ref|XP_019198650.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Ipomoea nil] Length = 432 Score = 70.1 bits (170), Expect = 4e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYRVKHVLRPSELGLVLL Sbjct: 400 LKFGPGDGKLHYYLYNYRVKHVLRPSELGLVLL 432 >gb|PHU15025.1| Glycylpeptide N-tetradecanoyltransferase 2 [Capsicum chinense] Length = 432 Score = 69.7 bits (169), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGPGDGKLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_016578562.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Capsicum annuum] ref|XP_016578563.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Capsicum annuum] gb|PHT79295.1| Glycylpeptide N-tetradecanoyltransferase 2 [Capsicum annuum] Length = 432 Score = 69.7 bits (169), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGPGDGKLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_017253901.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Daucus carota subsp. sativus] gb|KZM92889.1| hypothetical protein DCAR_016134 [Daucus carota subsp. sativus] Length = 436 Score = 69.7 bits (169), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELGLVLL Sbjct: 404 LKFGPGDGKLHYYLYNYRIKHVLRPSELGLVLL 436 >gb|PHT45874.1| Glycylpeptide N-tetradecanoyltransferase 2 [Capsicum baccatum] Length = 432 Score = 69.3 bits (168), Expect = 8e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGLGDGKLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_017254824.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Daucus carota subsp. sativus] gb|KZM89936.1| hypothetical protein DCAR_022701 [Daucus carota subsp. sativus] Length = 436 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELGLVLL Sbjct: 404 LKFGPGDGKLHYYLYNYRLKHVLRPSELGLVLL 436 >ref|XP_015080217.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Solanum pennellii] Length = 432 Score = 68.2 bits (165), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDG+LHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGPGDGQLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_006357393.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Solanum tuberosum] Length = 432 Score = 68.2 bits (165), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDG+LHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGPGDGQLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_004241898.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Solanum lycopersicum] Length = 432 Score = 68.2 bits (165), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDG+LHYYLYNYR+KHVLRPSELGLVLL Sbjct: 400 LKFGPGDGQLHYYLYNYRIKHVLRPSELGLVLL 432 >ref|XP_020209922.1| glycylpeptide N-tetradecanoyltransferase 1-like [Cajanus cajan] Length = 181 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR++H L+PSELGLVLL Sbjct: 149 LKFGPGDGKLHYYLYNYRIRHALKPSELGLVLL 181 >ref|XP_011072547.1| glycylpeptide N-tetradecanoyltransferase 1-like [Sesamum indicum] Length = 432 Score = 67.8 bits (164), Expect = 3e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR++HVLRPSELGLVLL Sbjct: 400 LKFGPGDGKLHYYLYNYRLRHVLRPSELGLVLL 432 >gb|KYP78184.1| Glycylpeptide N-tetradecanoyltransferase 1, partial [Cajanus cajan] Length = 195 Score = 65.9 bits (159), Expect = 3e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR++H L+PSELGLVLL Sbjct: 163 LKFGPGDGKLHYYLYNYRIRHALKPSELGLVLL 195 >gb|PIN20658.1| N-myristoyl transferase [Handroanthus impetiginosus] Length = 432 Score = 67.4 bits (163), Expect = 4e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KHVLRPSELG VLL Sbjct: 400 LKFGPGDGKLHYYLYNYRLKHVLRPSELGFVLL 432 >gb|KVI10323.1| Acyl-CoA N-acyltransferase [Cynara cardunculus var. scolymus] Length = 459 Score = 67.4 bits (163), Expect = 4e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LK+G GDGKLHYYLYNYR+KH+LRPSELGLVLL Sbjct: 427 LKYGPGDGKLHYYLYNYRLKHILRPSELGLVLL 459 >ref|XP_022013339.1| glycylpeptide N-tetradecanoyltransferase 1-like [Helianthus annuus] Length = 426 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KH+LR SELGLVLL Sbjct: 394 LKFGPGDGKLHYYLYNYRIKHILRASELGLVLL 426 >ref|XP_022844650.1| glycylpeptide N-tetradecanoyltransferase 1-like [Olea europaea var. sylvestris] ref|XP_022844651.1| glycylpeptide N-tetradecanoyltransferase 1-like [Olea europaea var. sylvestris] Length = 432 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+K+VLRPSELGLVLL Sbjct: 400 LKFGPGDGKLHYYLYNYRLKNVLRPSELGLVLL 432 >gb|OTF96449.1| putative glycylpeptide N-tetradecanoyltransferase 2 [Helianthus annuus] Length = 433 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+KH+LR SELGLVLL Sbjct: 401 LKFGPGDGKLHYYLYNYRIKHILRASELGLVLL 433 >ref|XP_004505619.1| PREDICTED: glycylpeptide N-tetradecanoyltransferase 1-like [Cicer arietinum] Length = 434 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYRV+H L+PSELGLVLL Sbjct: 402 LKFGPGDGKLHYYLYNYRVRHALKPSELGLVLL 434 >ref|XP_022844648.1| glycylpeptide N-tetradecanoyltransferase 1-like [Olea europaea var. sylvestris] Length = 451 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR+K+VLRPSELGLVLL Sbjct: 419 LKFGPGDGKLHYYLYNYRLKNVLRPSELGLVLL 451 >gb|KYP63635.1| Glycylpeptide N-tetradecanoyltransferase 1 [Cajanus cajan] gb|KYP63636.1| Glycylpeptide N-tetradecanoyltransferase 1 [Cajanus cajan] Length = 418 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 466 LKFGQGDGKLHYYLYNYRVKHVLRPSELGLVLL 368 LKFG GDGKLHYYLYNYR++H L+PSELGLVLL Sbjct: 386 LKFGPGDGKLHYYLYNYRIRHALKPSELGLVLL 418