BLASTX nr result
ID: Acanthopanax21_contig00015401
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00015401 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275474.1| PREDICTED: LETM1 and EF-hand domain-containi... 50 2e-07 ref|XP_017223148.1| PREDICTED: LETM1 and EF-hand domain-containi... 46 1e-06 >ref|XP_002275474.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] ref|XP_010650730.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] ref|XP_010650731.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] ref|XP_019075713.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial [Vitis vinifera] emb|CBI24725.3| unnamed protein product, partial [Vitis vinifera] Length = 764 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 631 GEKEAMKAYRAVREENDEAAKVLVGDEVSS 720 GEKEAM+AYRA R+E+D AAKV VGDEVSS Sbjct: 637 GEKEAMEAYRAARDESDHAAKVAVGDEVSS 666 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 584 SVSTEREEFLRLVNKEVK 637 SVS EREEFLRLVNKE++ Sbjct: 607 SVSREREEFLRLVNKEIE 624 >ref|XP_017223148.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Daucus carota subsp. sativus] gb|KZM85071.1| hypothetical protein DCAR_027507 [Daucus carota subsp. sativus] Length = 763 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 631 GEKEAMKAYRAVREENDEAAKVLVGDEVSS 720 GEKEAMKAYRA EEND+ A+V G+EVSS Sbjct: 632 GEKEAMKAYRAAHEENDQDAEVNAGNEVSS 661 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 584 SVSTEREEFLRLVNKEV 634 SVSTEREEFLRLVNKE+ Sbjct: 602 SVSTEREEFLRLVNKEI 618