BLASTX nr result
ID: Acanthopanax21_contig00015243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00015243 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017217647.1| PREDICTED: gamma-interferon-inducible lysoso... 57 2e-06 >ref|XP_017217647.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Daucus carota subsp. sativus] Length = 237 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 1 HVCQAYTGRNRPAACNTPPEINSSEIANSVPQVCY 105 H+C+AYTG NRP AC+ PPEI S I NS PQVCY Sbjct: 196 HICKAYTGPNRPEACSRPPEIIPSNIENSDPQVCY 230