BLASTX nr result
ID: Acanthopanax21_contig00014881
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00014881 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017248649.1| PREDICTED: mRNA-decapping enzyme subunit 2 [... 60 2e-07 >ref|XP_017248649.1| PREDICTED: mRNA-decapping enzyme subunit 2 [Daucus carota subsp. sativus] gb|KZM95862.1| hypothetical protein DCAR_019104 [Daucus carota subsp. sativus] Length = 322 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -1 Query: 512 STTTTESPLIKPKQDDLSSATVPPGRSFRNFRFDTGSIFRAMESAFSS 369 S T ES +KPK + SSA + PGRSFRNFRFDTG IF+AME+AFSS Sbjct: 276 SATIAESLAVKPKANTQSSA-MGPGRSFRNFRFDTGLIFQAMETAFSS 322