BLASTX nr result
ID: Acanthopanax21_contig00014648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00014648 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019241608.1| PREDICTED: bZIP transcription factor 16-like... 55 5e-06 ref|XP_009771401.1| PREDICTED: transcription factor HBP-1a-like ... 55 5e-06 >ref|XP_019241608.1| PREDICTED: bZIP transcription factor 16-like [Nicotiana attenuata] gb|OIT19307.1| bzip transcription factor 16 [Nicotiana attenuata] Length = 408 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 343 MGSSEMDKPTKDAKEAKEPKNPTSQEQALPTGAGTV 450 MGSSEMDK +K+AKEAKEPK P SQEQA T AG+V Sbjct: 1 MGSSEMDKSSKEAKEAKEPKTPNSQEQASTTTAGSV 36 >ref|XP_009771401.1| PREDICTED: transcription factor HBP-1a-like [Nicotiana sylvestris] ref|XP_016490158.1| PREDICTED: bZIP transcription factor 16-like [Nicotiana tabacum] Length = 408 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 343 MGSSEMDKPTKDAKEAKEPKNPTSQEQALPTGAGTV 450 MGSSEMDK +K+AKEAKEPK P SQEQA T AG+V Sbjct: 1 MGSSEMDKSSKEAKEAKEPKTPNSQEQASTTTAGSV 36