BLASTX nr result
ID: Acanthopanax21_contig00014351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00014351 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017229629.1| PREDICTED: two-component response regulator ... 63 3e-08 ref|XP_017229628.1| PREDICTED: two-component response regulator ... 63 3e-08 >ref|XP_017229629.1| PREDICTED: two-component response regulator ORR21-like isoform X2 [Daucus carota subsp. sativus] Length = 574 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 KVKQEPNLDFIENVNMGNPTLQHFSPNDLTSVFSE 106 KVKQEPNLDFIE+VNM NP +Q+FSPND+ SVFSE Sbjct: 540 KVKQEPNLDFIESVNMSNPMMQYFSPNDVMSVFSE 574 >ref|XP_017229628.1| PREDICTED: two-component response regulator ARR14-like isoform X1 [Daucus carota subsp. sativus] gb|KZN10021.1| hypothetical protein DCAR_002677 [Daucus carota subsp. sativus] Length = 661 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 KVKQEPNLDFIENVNMGNPTLQHFSPNDLTSVFSE 106 KVKQEPNLDFIE+VNM NP +Q+FSPND+ SVFSE Sbjct: 627 KVKQEPNLDFIESVNMSNPMMQYFSPNDVMSVFSE 661