BLASTX nr result
ID: Acanthopanax21_contig00014194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00014194 (622 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017222792.1| PREDICTED: uncharacterized protein LOC108199... 101 1e-22 ref|XP_017250709.1| PREDICTED: zinc finger BED domain-containing... 99 1e-20 ref|XP_008804919.1| PREDICTED: zinc finger BED domain-containing... 87 2e-18 ref|XP_012850967.1| PREDICTED: uncharacterized protein LOC105970... 92 8e-18 ref|XP_012438651.1| PREDICTED: uncharacterized protein LOC105764... 86 1e-17 ref|XP_008779859.1| PREDICTED: zinc finger BED domain-containing... 86 1e-17 gb|OTG22769.1| putative zinc finger, BED-type [Helianthus annuus] 91 1e-17 ref|XP_021995786.1| zinc finger BED domain-containing protein RI... 90 3e-17 ref|XP_023756527.1| zinc finger BED domain-containing protein RI... 89 5e-17 ref|XP_012465932.1| PREDICTED: zinc finger BED domain-containing... 83 7e-17 dbj|GAU25736.1| hypothetical protein TSUD_216670 [Trifolium subt... 84 8e-17 ref|XP_012486481.1| PREDICTED: zinc finger BED domain-containing... 88 9e-17 ref|XP_012465931.1| PREDICTED: zinc finger BED domain-containing... 83 1e-16 gb|KYP62188.1| Putative AC transposase [Cajanus cajan] 88 1e-16 ref|XP_020221020.1| zinc finger BED domain-containing protein RI... 88 1e-16 gb|PRQ57352.1| putative HAT dimerization domain, ribonuclease H-... 83 1e-16 ref|XP_017248441.1| PREDICTED: zinc finger BED domain-containing... 86 2e-16 ref|XP_023748565.1| zinc finger BED domain-containing protein RI... 85 2e-16 gb|PNX57783.1| transposon protein [Trifolium pratense] 85 2e-16 ref|XP_016740023.1| PREDICTED: zinc finger BED domain-containing... 86 3e-16 >ref|XP_017222792.1| PREDICTED: uncharacterized protein LOC108199480 [Daucus carota subsp. sativus] ref|XP_017222793.1| PREDICTED: uncharacterized protein LOC108199480 [Daucus carota subsp. sativus] ref|XP_017222794.1| PREDICTED: uncharacterized protein LOC108199480 [Daucus carota subsp. sativus] Length = 252 Score = 101 bits (251), Expect = 1e-22 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQ 455 ILSKIARHVLGMP+S+V SEAAFST GRTIDAYRSSLSPKTVEALIC+QDWLR S+ Sbjct: 160 ILSKIARHVLGMPVSSVASEAAFSTSGRTIDAYRSSLSPKTVEALICSQDWLRTSE 215 >ref|XP_017250709.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like, partial [Daucus carota subsp. sativus] Length = 461 Score = 99.0 bits (245), Expect = 1e-20 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 ILS++ARHVLGMP+S+V SE AFSTGGRTIDAYRSSLSPKT EALIC+QDWLR S T Sbjct: 404 ILSEMARHVLGMPVSSVASEVAFSTGGRTIDAYRSSLSPKTAEALICSQDWLRTSDT 460 >ref|XP_008804919.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 134 Score = 87.4 bits (215), Expect = 2e-18 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLR 464 ILS++AR VL +P+STV+SE+AFSTGGR +D YRSSLSP TVEAL+CTQDWLR Sbjct: 52 ILSRMARDVLAIPVSTVSSESAFSTGGRVVDQYRSSLSPSTVEALVCTQDWLR 104 >ref|XP_012850967.1| PREDICTED: uncharacterized protein LOC105970681 [Erythranthe guttata] Length = 1098 Score = 91.7 bits (226), Expect = 8e-18 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 ILS+IARHVL MPISTV SE+AFS GGR ID +RSSLSPKT EALIC QDW+R+S T Sbjct: 643 ILSQIARHVLAMPISTVASESAFSVGGRVIDPFRSSLSPKTAEALICAQDWIRSSPT 699 >ref|XP_012438651.1| PREDICTED: uncharacterized protein LOC105764568 isoform X3 [Gossypium raimondii] Length = 144 Score = 85.5 bits (210), Expect = 1e-17 Identities = 38/56 (67%), Positives = 48/56 (85%) Frame = -1 Query: 619 LSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 LSKIAR VL +P+STV SE+AFSTGGR +D YRSSL+PK ++AL+CTQDW+R S + Sbjct: 51 LSKIARDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIIQALVCTQDWIRKSSS 106 >ref|XP_008779859.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 160 Score = 85.9 bits (211), Expect = 1e-17 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLR 464 ILS++A+ VL +P+STV+SE+AFSTGGR +D YRSSLSP TVEAL+CTQDWLR Sbjct: 81 ILSRMAQDVLAIPVSTVSSESAFSTGGRVVDQYRSSLSPSTVEALVCTQDWLR 133 >gb|OTG22769.1| putative zinc finger, BED-type [Helianthus annuus] Length = 788 Score = 90.9 bits (224), Expect = 1e-17 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLR 464 +LS++ARHVLGMPISTV SE+AFSTGGR ID YRSSL+PKT E LIC+QDW+R Sbjct: 688 VLSQLARHVLGMPISTVASESAFSTGGRVIDTYRSSLTPKTAETLICSQDWIR 740 >ref|XP_021995786.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Helianthus annuus] Length = 860 Score = 90.1 bits (222), Expect = 3e-17 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNS 458 +LS+IA+HVLGMPISTV SE+AFSTGGR ID YRSSL+PKT E LIC QDWLR++ Sbjct: 757 VLSEIAKHVLGMPISTVASESAFSTGGRVIDKYRSSLTPKTGEGLICAQDWLRST 811 >ref|XP_023756527.1| zinc finger BED domain-containing protein RICESLEEPER 1-like [Lactuca sativa] Length = 403 Score = 88.6 bits (218), Expect = 5e-17 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQTFV 446 ILSK+ARH+L MPIST+ SE+ FSTGGR ID YRSSL+ KT EALIC QDWLR++ F+ Sbjct: 279 ILSKLARHLLAMPISTIASESTFSTGGRVIDKYRSSLNTKTAEALICRQDWLRSTPAFL 337 >ref|XP_012465932.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium raimondii] Length = 131 Score = 83.2 bits (204), Expect = 7e-17 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 619 LSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNS 458 LSK+AR VL +PISTV SE+AFSTGGR +D YRSSL+PK V+AL+CTQDW++ S Sbjct: 56 LSKMARDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIQKS 109 >dbj|GAU25736.1| hypothetical protein TSUD_216670 [Trifolium subterraneum] Length = 166 Score = 84.0 bits (206), Expect = 8e-17 Identities = 38/57 (66%), Positives = 48/57 (84%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 +L++I+R VL +P+STV SE+AFSTGGR +DAYRSSLS TVEALICTQDW++ T Sbjct: 73 VLARISREVLAIPVSTVASESAFSTGGRVLDAYRSSLSSTTVEALICTQDWVKKKMT 129 >ref|XP_012486481.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Gossypium raimondii] Length = 457 Score = 88.2 bits (217), Expect = 9e-17 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -1 Query: 619 LSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 LSKIAR VL +PISTVTSE+AFSTGGR +D YRSSL+PK V+AL+CTQDW+R S + Sbjct: 364 LSKIARDVLAIPISTVTSESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSSS 419 >ref|XP_012465931.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Gossypium raimondii] Length = 143 Score = 83.2 bits (204), Expect = 1e-16 Identities = 38/54 (70%), Positives = 47/54 (87%) Frame = -1 Query: 619 LSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNS 458 LSK+AR VL +PISTV SE+AFSTGGR +D YRSSL+PK V+AL+CTQDW++ S Sbjct: 56 LSKMARDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIQKS 109 >gb|KYP62188.1| Putative AC transposase [Cajanus cajan] Length = 605 Score = 88.2 bits (217), Expect = 1e-16 Identities = 43/77 (55%), Positives = 55/77 (71%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQTFVY 443 IL IAR VL +P+STV SE++FSTGGR +D YRSSL+P+ VEAL+CTQDWL+ S FV+ Sbjct: 529 ILGSIAREVLAIPVSTVASESSFSTGGRVLDPYRSSLTPRMVEALVCTQDWLKGSSFFVF 588 Query: 442 XXXXXXXXXQFENIEKM 392 FE +EK+ Sbjct: 589 ------TNEDFEELEKL 599 >ref|XP_020221020.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Cajanus cajan] Length = 677 Score = 88.2 bits (217), Expect = 1e-16 Identities = 43/77 (55%), Positives = 55/77 (71%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQTFVY 443 IL IAR VL +P+STV SE++FSTGGR +D YRSSL+P+ VEAL+CTQDWL+ S FV+ Sbjct: 587 ILGSIAREVLAIPVSTVASESSFSTGGRVLDPYRSSLTPRMVEALVCTQDWLKGSSFFVF 646 Query: 442 XXXXXXXXXQFENIEKM 392 FE +EK+ Sbjct: 647 ------TNEDFEELEKL 657 >gb|PRQ57352.1| putative HAT dimerization domain, ribonuclease H-like domain-containing protein [Rosa chinensis] Length = 146 Score = 82.8 bits (203), Expect = 1e-16 Identities = 37/60 (61%), Positives = 50/60 (83%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQTFVY 443 IL++IAR VL +P+ST+ SE++FST GR ID YRSSLSP+ VEALICTQ+WLR+ +++ Sbjct: 41 ILARIARDVLAIPVSTIASESSFSTSGRIIDPYRSSLSPRMVEALICTQNWLRSENVYLH 100 >ref|XP_017248441.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Daucus carota subsp. sativus] Length = 290 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 ILS +A++VL MPI+TV SE+AFSTGGR ID +RSSL+PKT EALIC QDWLR+ T Sbjct: 196 ILSSVAKNVLAMPITTVASESAFSTGGRVIDPFRSSLTPKTAEALICAQDWLRSKPT 252 >ref|XP_023748565.1| zinc finger BED domain-containing protein RICESLEEPER 3-like [Lactuca sativa] Length = 262 Score = 85.1 bits (209), Expect = 2e-16 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNS 458 ILSK+A+HVL MPIST+ SE+AFSTGGR ID YRSSL+ T +ALIC QDW+R+S Sbjct: 168 ILSKVAKHVLAMPISTIASESAFSTGGRVIDKYRSSLNTDTAKALICVQDWIRSS 222 >gb|PNX57783.1| transposon protein [Trifolium pratense] Length = 244 Score = 84.7 bits (208), Expect = 2e-16 Identities = 40/59 (67%), Positives = 50/59 (84%) Frame = -1 Query: 622 ILSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQTFV 446 IL ++AR +L +P+STV SE+AFSTGGR ++ YRSSLSPKTVEALICTQ+W R+SQ V Sbjct: 154 ILGQMARDILAIPLSTVASESAFSTGGRVLNNYRSSLSPKTVEALICTQNWCRSSQVSV 212 >ref|XP_016740023.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium hirsutum] Length = 345 Score = 85.9 bits (211), Expect = 3e-16 Identities = 39/56 (69%), Positives = 48/56 (85%) Frame = -1 Query: 619 LSKIARHVLGMPISTVTSEAAFSTGGRTIDAYRSSLSPKTVEALICTQDWLRNSQT 452 LSKIAR VL +P+STV SE+AFSTGGR +D YRSSL+PK V+AL+CTQDW+R S + Sbjct: 258 LSKIARDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDWIRRSSS 313