BLASTX nr result
ID: Acanthopanax21_contig00013716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00013716 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017620110.1| PREDICTED: arginyl-tRNA--protein transferase... 55 6e-06 ref|XP_016719277.1| PREDICTED: arginyl-tRNA--protein transferase... 55 6e-06 ref|XP_012455789.1| PREDICTED: arginyl-tRNA--protein transferase... 55 6e-06 >ref|XP_017620110.1| PREDICTED: arginyl-tRNA--protein transferase 2 [Gossypium arboreum] Length = 628 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 DIQHALKGPAERRYMETKLHKYMKVVGVTLSERMVFSLG 118 D+Q A GP+ER Y+ET+LH Y +VVGV LSERMV+SLG Sbjct: 591 DLQRAF-GPSERNYLETQLHSYQRVVGVELSERMVYSLG 628 >ref|XP_016719277.1| PREDICTED: arginyl-tRNA--protein transferase 2-like [Gossypium hirsutum] Length = 628 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 DIQHALKGPAERRYMETKLHKYMKVVGVTLSERMVFSLG 118 D+Q A GP+ER Y+ET+LH Y +VVGV LSERMV+SLG Sbjct: 591 DLQQAF-GPSERNYLETQLHSYQRVVGVELSERMVYSLG 628 >ref|XP_012455789.1| PREDICTED: arginyl-tRNA--protein transferase 2-like [Gossypium raimondii] gb|KJB74299.1| hypothetical protein B456_011G285800 [Gossypium raimondii] gb|KJB74300.1| hypothetical protein B456_011G285800 [Gossypium raimondii] gb|KJB74301.1| hypothetical protein B456_011G285800 [Gossypium raimondii] Length = 628 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +2 Query: 2 DIQHALKGPAERRYMETKLHKYMKVVGVTLSERMVFSLG 118 D+Q A GP+ER Y+ET+LH Y +VVGV LSERMV+SLG Sbjct: 591 DLQQAF-GPSERNYLETQLHSYQRVVGVELSERMVYSLG 628