BLASTX nr result
ID: Acanthopanax21_contig00013679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00013679 (708 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010036074.1| PREDICTED: OTU domain-containing protein DDB... 71 3e-11 ref|XP_017248423.1| PREDICTED: OTU domain-containing protein DDB... 69 3e-10 gb|PIN06070.1| 7-deoxyloganetin glucosyltransferase [Handroanthu... 67 6e-10 ref|XP_009626134.1| PREDICTED: OTU domain-containing protein DDB... 64 9e-10 gb|OWM77699.1| hypothetical protein CDL15_Pgr022372 [Punica gran... 66 3e-09 ref|XP_010112865.2| OTU domain-containing protein DDB_G0284757 [... 65 4e-09 gb|PHT42645.1| hypothetical protein CQW23_16670 [Capsicum baccatum] 65 4e-09 ref|XP_016580404.1| PREDICTED: OTU domain-containing protein DDB... 65 4e-09 ref|XP_010687223.1| PREDICTED: OTU domain-containing protein DDB... 64 9e-09 ref|XP_011100382.1| OTU domain-containing protein DDB_G0284757 [... 64 9e-09 ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB... 64 1e-08 ref|XP_008342290.1| PREDICTED: OTU domain-containing protein DDB... 64 1e-08 ref|XP_010687222.1| PREDICTED: OTU domain-containing protein DDB... 64 1e-08 ref|XP_021838126.1| OTU domain-containing protein DDB_G0284757 [... 64 1e-08 ref|XP_006357883.1| PREDICTED: OTU domain-containing protein DDB... 64 1e-08 ref|XP_004243635.1| PREDICTED: OTU domain-containing protein DDB... 64 1e-08 gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium r... 63 1e-08 ref|XP_020995345.1| OTU domain-containing protein DDB_G0284757 i... 64 1e-08 ref|XP_020976027.1| OTU domain-containing protein DDB_G0284757 i... 64 1e-08 ref|XP_016197000.1| OTU domain-containing protein DDB_G0284757 i... 64 1e-08 >ref|XP_010036074.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Eucalyptus grandis] gb|KCW47595.1| hypothetical protein EUGRSUZ_K01340 [Eucalyptus grandis] Length = 227 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -1 Query: 615 NFKED--YTLFQHGETTNIEIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 +FKE + +G+T E+WLSFWSEVHYNSLYERG+VPA+ P+KKHW Sbjct: 176 SFKETSYIEIVPNGKTPTKELWLSFWSEVHYNSLYERGDVPAQKPRKKHW 225 >ref|XP_017248423.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] ref|XP_017248424.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] ref|XP_017248425.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] Length = 233 Score = 68.6 bits (166), Expect = 3e-10 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHWYS 466 E+WLSFWSE+HYNSLYERG+VP R KKKHWY+ Sbjct: 196 ELWLSFWSEIHYNSLYERGDVPVRAAKKKHWYN 228 >gb|PIN06070.1| 7-deoxyloganetin glucosyltransferase [Handroanthus impetiginosus] Length = 190 Score = 67.0 bits (162), Expect = 6e-10 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 594 LFQHGETTNIEIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 L Q G + E+WLSFWSEVHYNSLY+ GEVP RT +KKHW Sbjct: 148 LIQAGVISENELWLSFWSEVHYNSLYQAGEVPTRTHRKKHW 188 >ref|XP_009626134.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana tomentosiformis] ref|XP_016490157.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana tabacum] Length = 89 Score = 63.9 bits (154), Expect = 9e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLYE GEVPAR +KKHW Sbjct: 57 ELWLSFWSEVHYNSLYEIGEVPARVRRKKHW 87 >gb|OWM77699.1| hypothetical protein CDL15_Pgr022372 [Punica granatum] Length = 230 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 ++WLSFWSEVHYNSLYERG+VP R P+KKHW Sbjct: 197 QLWLSFWSEVHYNSLYERGDVPMRKPRKKHW 227 >ref|XP_010112865.2| OTU domain-containing protein DDB_G0284757 [Morus notabilis] Length = 226 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLY G+VP RTP+KKHW Sbjct: 194 EVWLSFWSEVHYNSLYATGDVPTRTPRKKHW 224 >gb|PHT42645.1| hypothetical protein CQW23_16670 [Capsicum baccatum] Length = 231 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLYE GE PAR P+KKHW Sbjct: 198 ELWLSFWSEVHYNSLYEIGEAPARIPRKKHW 228 >ref|XP_016580404.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Capsicum annuum] ref|XP_016580405.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Capsicum annuum] gb|PHT76022.1| hypothetical protein T459_19544 [Capsicum annuum] Length = 231 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLYE GE PAR P+KKHW Sbjct: 198 ELWLSFWSEVHYNSLYEIGEAPARIPRKKHW 228 >ref|XP_010687223.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 221 Score = 64.3 bits (155), Expect = 9e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 EIWLSFWSEVHYNSLY+ G+VPAR P+KK+W Sbjct: 189 EIWLSFWSEVHYNSLYDNGDVPARIPRKKYW 219 >ref|XP_011100382.1| OTU domain-containing protein DDB_G0284757 [Sesamum indicum] ref|XP_011100383.1| OTU domain-containing protein DDB_G0284757 [Sesamum indicum] ref|XP_011100384.1| OTU domain-containing protein DDB_G0284757 [Sesamum indicum] ref|XP_011100388.1| OTU domain-containing protein DDB_G0284757 [Sesamum indicum] ref|XP_020554992.1| OTU domain-containing protein DDB_G0284757 [Sesamum indicum] Length = 226 Score = 64.3 bits (155), Expect = 9e-09 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLY+ GEVP RT +KKHW Sbjct: 194 ELWLSFWSEVHYNSLYQAGEVPTRTQRKKHW 224 >ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] ref|XP_009377958.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] Length = 227 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHWYS 466 E+WLSFWSEVHYNSLY +VP+RTP+KKHW S Sbjct: 194 ELWLSFWSEVHYNSLYASADVPSRTPRKKHWLS 226 >ref|XP_008342290.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Malus domestica] Length = 227 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHWYS 466 E+WLSFWSEVHYNSLY +VP+RTP+KKHW S Sbjct: 194 ELWLSFWSEVHYNSLYASADVPSRTPRKKHWLS 226 >ref|XP_010687222.1| PREDICTED: OTU domain-containing protein DDB_G0284757 isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT03696.1| hypothetical protein BVRB_8g188470 [Beta vulgaris subsp. vulgaris] Length = 228 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 EIWLSFWSEVHYNSLY+ G+VPAR P+KK+W Sbjct: 196 EIWLSFWSEVHYNSLYDNGDVPARIPRKKYW 226 >ref|XP_021838126.1| OTU domain-containing protein DDB_G0284757 [Spinacia oleracea] ref|XP_021838127.1| OTU domain-containing protein DDB_G0284757 [Spinacia oleracea] gb|KNA10471.1| hypothetical protein SOVF_144170 [Spinacia oleracea] Length = 232 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 EIWLSFWSEVHYNSLY+ G+VP+R P+KKHW Sbjct: 200 EIWLSFWSEVHYNSLYDIGDVPSRLPRKKHW 230 >ref|XP_006357883.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Solanum tuberosum] ref|XP_006357884.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Solanum tuberosum] Length = 232 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLYE GE P R P+KKHW Sbjct: 199 ELWLSFWSEVHYNSLYEIGEAPVRVPRKKHW 229 >ref|XP_004243635.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Solanum lycopersicum] ref|XP_015080845.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Solanum pennellii] Length = 232 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 E+WLSFWSEVHYNSLYE GE P R P+KKHW Sbjct: 199 ELWLSFWSEVHYNSLYEIGEAPVRVPRKKHW 229 >gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium raimondii] Length = 160 Score = 62.8 bits (151), Expect = 1e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 564 EIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 EIWLSFWSEVHYNSLY G+VP R P++KHW Sbjct: 128 EIWLSFWSEVHYNSLYASGDVPTRAPRRKHW 158 >ref|XP_020995345.1| OTU domain-containing protein DDB_G0284757 isoform X2 [Arachis duranensis] Length = 222 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 567 IEIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 IE+WLSFWSEVHYNSLY G+VPAR P+KK+W Sbjct: 189 IELWLSFWSEVHYNSLYASGDVPARAPRKKYW 220 >ref|XP_020976027.1| OTU domain-containing protein DDB_G0284757 isoform X2 [Arachis ipaensis] Length = 222 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 567 IEIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 IE+WLSFWSEVHYNSLY G+VPAR P+KK+W Sbjct: 189 IELWLSFWSEVHYNSLYASGDVPARAPRKKYW 220 >ref|XP_016197000.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Arachis ipaensis] ref|XP_016197001.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Arachis ipaensis] Length = 226 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 567 IEIWLSFWSEVHYNSLYERGEVPARTPKKKHW 472 IE+WLSFWSEVHYNSLY G+VPAR P+KK+W Sbjct: 193 IELWLSFWSEVHYNSLYASGDVPARAPRKKYW 224