BLASTX nr result
ID: Acanthopanax21_contig00013662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00013662 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017218981.1| PREDICTED: probable sugar phosphate/phosphat... 81 8e-15 ref|XP_010546568.1| PREDICTED: probable sugar phosphate/phosphat... 80 1e-14 dbj|GAV88373.1| TPT domain-containing protein [Cephalotus follic... 78 7e-14 ref|XP_011081573.1| probable sugar phosphate/phosphate transloca... 78 7e-14 ref|XP_011081565.1| probable sugar phosphate/phosphate transloca... 78 7e-14 gb|ABR25854.1| plastidic phosphate translocator-like protein1, p... 72 8e-14 ref|XP_016454130.1| PREDICTED: probable sugar phosphate/phosphat... 76 1e-13 ref|XP_020209932.1| probable sugar phosphate/phosphate transloca... 72 2e-13 ref|XP_016537722.1| PREDICTED: probable sugar phosphate/phosphat... 74 2e-13 ref|XP_012857863.1| PREDICTED: probable sugar phosphate/phosphat... 77 2e-13 emb|CDP13499.1| unnamed protein product [Coffea canephora] 77 3e-13 gb|PPD79239.1| hypothetical protein GOBAR_DD23855 [Gossypium bar... 71 4e-13 gb|AFK47238.1| unknown [Medicago truncatula] 71 4e-13 ref|XP_019230440.1| PREDICTED: probable sugar phosphate/phosphat... 76 4e-13 ref|XP_009775253.1| PREDICTED: probable sugar phosphate/phosphat... 76 4e-13 dbj|BAH20316.1| AT2G25520, partial [Arabidopsis thaliana] 74 4e-13 ref|XP_024167184.1| probable sugar phosphate/phosphate transloca... 75 7e-13 ref|XP_012076592.1| probable sugar phosphate/phosphate transloca... 75 7e-13 gb|PIN21606.1| Glucose-6-phosphate/phosphate and phosphoenolpyru... 75 9e-13 ref|XP_021665606.1| probable sugar phosphate/phosphate transloca... 75 1e-12 >ref|XP_017218981.1| PREDICTED: probable sugar phosphate/phosphate translocator At5g25400 [Daucus carota subsp. sativus] gb|KZN10437.1| hypothetical protein DCAR_003093 [Daucus carota subsp. sativus] Length = 345 Score = 80.9 bits (198), Expect = 8e-15 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQPQ 395 DTVTP+NL+GYGLAFLGVGYYNHAKLQAMKAKEAQKK Q Q Sbjct: 285 DTVTPINLIGYGLAFLGVGYYNHAKLQAMKAKEAQKKAQTQ 325 >ref|XP_010546568.1| PREDICTED: probable sugar phosphate/phosphate translocator At2g25520 [Tarenaya hassleriana] Length = 349 Score = 80.1 bits (196), Expect = 1e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQP 398 DTVTP+NL GYGLAFLGVGYYNH+KLQA+KAKEAQKKTQP Sbjct: 285 DTVTPINLFGYGLAFLGVGYYNHSKLQALKAKEAQKKTQP 324 >dbj|GAV88373.1| TPT domain-containing protein [Cephalotus follicularis] Length = 349 Score = 78.2 bits (191), Expect = 7e-14 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQP 398 DTVTP+NL GYGLAFLGVGYYNH+KLQA+KAKEAQKK QP Sbjct: 285 DTVTPINLFGYGLAFLGVGYYNHSKLQALKAKEAQKKAQP 324 >ref|XP_011081573.1| probable sugar phosphate/phosphate translocator At2g25520 [Sesamum indicum] Length = 350 Score = 78.2 bits (191), Expect = 7e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQPQ 395 DTVTP+NL GYGLAFLGVGYYNH KLQA+KAKEAQKK QP+ Sbjct: 286 DTVTPINLFGYGLAFLGVGYYNHLKLQALKAKEAQKKAQPE 326 >ref|XP_011081565.1| probable sugar phosphate/phosphate translocator At2g25520 [Sesamum indicum] Length = 350 Score = 78.2 bits (191), Expect = 7e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQPQ 395 DTVTP+NL GYGLAFLGVGYYNH KLQA+KAKEAQKK QP+ Sbjct: 286 DTVTPINLFGYGLAFLGVGYYNHLKLQALKAKEAQKKAQPE 326 >gb|ABR25854.1| plastidic phosphate translocator-like protein1, partial [Oryza sativa Indica Group] Length = 66 Score = 72.4 bits (176), Expect = 8e-14 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKK 407 DTVTP+NL GYG+AFLGVGYYNH KLQA+KAKEAQKK Sbjct: 3 DTVTPINLFGYGIAFLGVGYYNHVKLQALKAKEAQKK 39 >ref|XP_016454130.1| PREDICTED: probable sugar phosphate/phosphate translocator At2g25520, partial [Nicotiana tabacum] Length = 243 Score = 76.3 bits (186), Expect = 1e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTPVNL+GYGLAFLGV YYNH KLQA+KAKEAQKKTQ Sbjct: 177 DTVTPVNLIGYGLAFLGVAYYNHQKLQALKAKEAQKKTQ 215 >ref|XP_020209932.1| probable sugar phosphate/phosphate translocator At4g32390 [Cajanus cajan] Length = 82 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKT 404 DTVTP+NL GYGLAFLGV YYNH+KLQA+KAK+AQKKT Sbjct: 22 DTVTPINLFGYGLAFLGVAYYNHSKLQALKAKDAQKKT 59 >ref|XP_016537722.1| PREDICTED: probable sugar phosphate/phosphate translocator At4g32390 [Capsicum annuum] gb|PHT74185.1| putative sugar phosphate/phosphate translocator [Capsicum annuum] Length = 168 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTPVNL+GYGLAFLGV YYNH KLQA+KAKEAQKK Q Sbjct: 102 DTVTPVNLIGYGLAFLGVAYYNHQKLQALKAKEAQKKVQ 140 >ref|XP_012857863.1| PREDICTED: probable sugar phosphate/phosphate translocator At2g25520 [Erythranthe guttata] gb|EYU20272.1| hypothetical protein MIMGU_mgv1a021781mg [Erythranthe guttata] Length = 351 Score = 77.0 bits (188), Expect = 2e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQP 398 DTVTP+NL GYGLAFLGVGYYNH KLQA+KAKEAQKK QP Sbjct: 287 DTVTPMNLFGYGLAFLGVGYYNHCKLQALKAKEAQKKVQP 326 >emb|CDP13499.1| unnamed protein product [Coffea canephora] Length = 353 Score = 76.6 bits (187), Expect = 3e-13 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTP+NL+GYGLAFLGVGYYNH+KLQA+KAKEAQKK+Q Sbjct: 285 DTVTPMNLIGYGLAFLGVGYYNHSKLQALKAKEAQKKSQ 323 >gb|PPD79239.1| hypothetical protein GOBAR_DD23855 [Gossypium barbadense] Length = 86 Score = 71.2 bits (173), Expect = 4e-13 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKK 407 DTVTP+NL GYGLAFLGV YYNH+KLQA+KAKEAQKK Sbjct: 22 DTVTPINLFGYGLAFLGVAYYNHSKLQALKAKEAQKK 58 >gb|AFK47238.1| unknown [Medicago truncatula] Length = 86 Score = 71.2 bits (173), Expect = 4e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTP+NL+GYGLAFLGV YYNH+KLQA+KA E QKK Q Sbjct: 22 DTVTPINLIGYGLAFLGVAYYNHSKLQALKASETQKKAQ 60 >ref|XP_019230440.1| PREDICTED: probable sugar phosphate/phosphate translocator At2g25520 [Nicotiana attenuata] gb|OIT29432.1| putative sugar phosphatephosphate translocator [Nicotiana attenuata] Length = 351 Score = 76.3 bits (186), Expect = 4e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTPVNL+GYGLAFLGV YYNH KLQA+KAKEAQKKTQ Sbjct: 285 DTVTPVNLIGYGLAFLGVAYYNHQKLQALKAKEAQKKTQ 323 >ref|XP_009775253.1| PREDICTED: probable sugar phosphate/phosphate translocator At2g25520 [Nicotiana sylvestris] Length = 351 Score = 76.3 bits (186), Expect = 4e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTPVNL+GYGLAFLGV YYNH KLQA+KAKEAQKKTQ Sbjct: 285 DTVTPVNLIGYGLAFLGVAYYNHQKLQALKAKEAQKKTQ 323 >dbj|BAH20316.1| AT2G25520, partial [Arabidopsis thaliana] Length = 190 Score = 73.9 bits (180), Expect = 4e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTP+NL GYGLAFLGVGYYNH KLQA+KAK+AQKK Q Sbjct: 128 DTVTPINLFGYGLAFLGVGYYNHCKLQALKAKDAQKKVQ 166 >ref|XP_024167184.1| probable sugar phosphate/phosphate translocator At5g25400 [Rosa chinensis] gb|PRQ26759.1| putative sugar phosphate transporter domain-containing protein [Rosa chinensis] Length = 344 Score = 75.5 bits (184), Expect = 7e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQP 398 DTVTP+NLVGYGLAFLGV YYNH+KLQA+KAKEAQKK P Sbjct: 285 DTVTPINLVGYGLAFLGVAYYNHSKLQALKAKEAQKKVPP 324 >ref|XP_012076592.1| probable sugar phosphate/phosphate translocator At5g25400 [Jatropha curcas] Length = 349 Score = 75.5 bits (184), Expect = 7e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTP+NL GYGLAFLGV YYNHAKLQAMKAKEAQKK Q Sbjct: 285 DTVTPINLFGYGLAFLGVAYYNHAKLQAMKAKEAQKKAQ 323 >gb|PIN21606.1| Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Handroanthus impetiginosus] Length = 349 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQP 398 DTVTP+NL GYGLAFLGV YYNH+KLQA+KAKEAQKK QP Sbjct: 285 DTVTPLNLFGYGLAFLGVAYYNHSKLQALKAKEAQKKAQP 324 >ref|XP_021665606.1| probable sugar phosphate/phosphate translocator At5g25400 [Hevea brasiliensis] Length = 349 Score = 74.7 bits (182), Expect = 1e-12 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -2 Query: 517 DTVTPVNLVGYGLAFLGVGYYNHAKLQAMKAKEAQKKTQ 401 DTVTPVNL GYGLAFLGV YYNHAKLQA+KAKEAQKK Q Sbjct: 285 DTVTPVNLFGYGLAFLGVAYYNHAKLQALKAKEAQKKAQ 323