BLASTX nr result
ID: Acanthopanax21_contig00012452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00012452 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236152.1| PREDICTED: ion channel DMI1-like [Daucus car... 55 4e-08 >ref|XP_017236152.1| PREDICTED: ion channel DMI1-like [Daucus carota subsp. sativus] gb|KZN05838.1| hypothetical protein DCAR_006675 [Daucus carota subsp. sativus] Length = 911 Score = 55.1 bits (131), Expect(2) = 4e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 226 IFFSDQRFSVSNRNYIYPSFLGPYCFRTRVTVK 324 I SDQRF VS+R+Y+YPSFLGPY RTRVTVK Sbjct: 47 ISLSDQRFGVSDRDYVYPSFLGPYSSRTRVTVK 79 Score = 30.4 bits (67), Expect(2) = 4e-08 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 113 DSQPPHFSGPLFSVVHRFTSRP 178 D PPHF GPLF V R + P Sbjct: 22 DPPPPHFPGPLFPAVRRTAASP 43