BLASTX nr result
ID: Acanthopanax21_contig00012201
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00012201 (1045 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017255391.1| PREDICTED: UPF0496 protein At3g19330 [Daucus... 61 1e-06 gb|KZM91905.1| hypothetical protein DCAR_020730 [Daucus carota s... 61 2e-06 >ref|XP_017255391.1| PREDICTED: UPF0496 protein At3g19330 [Daucus carota subsp. sativus] Length = 377 Score = 60.8 bits (146), Expect = 1e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 VAKQLEKNRLNILRKLLDLEEHLCLCFAAINRARS 107 VAKQL KN LN LR+L DLEEHLCLCFAAINRAR+ Sbjct: 329 VAKQLYKNHLNFLRQLSDLEEHLCLCFAAINRARA 363 >gb|KZM91905.1| hypothetical protein DCAR_020730 [Daucus carota subsp. sativus] Length = 433 Score = 60.8 bits (146), Expect = 2e-06 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 VAKQLEKNRLNILRKLLDLEEHLCLCFAAINRARS 107 VAKQL KN LN LR+L DLEEHLCLCFAAINRAR+ Sbjct: 385 VAKQLYKNHLNFLRQLSDLEEHLCLCFAAINRARA 419