BLASTX nr result
ID: Acanthopanax21_contig00011416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00011416 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PAL60604.1| hypothetical protein CEJ83_21460, partial [Acinet... 127 1e-35 ref|XP_022962357.1| 40S ribosomal protein S6-like [Cucurbita mos... 131 4e-35 ref|XP_022948606.1| 40S ribosomal protein S6 [Cucurbita moschata... 131 4e-35 gb|EEF36525.1| 40S ribosomal protein S6, putative [Ricinus commu... 130 4e-35 ref|XP_008437828.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 131 4e-35 ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cu... 131 4e-35 ref|XP_018848971.1| PREDICTED: 40S ribosomal protein S6-like, pa... 129 5e-35 ref|XP_022131886.1| 40S ribosomal protein S6 [Momordica charantia] 131 6e-35 ref|XP_006355210.1| PREDICTED: 40S ribosomal protein S6-like [So... 129 6e-35 gb|PKI39417.1| hypothetical protein CRG98_040175, partial [Punic... 125 8e-35 ref|XP_004152628.1| PREDICTED: 40S ribosomal protein S6 [Cucumis... 130 1e-34 ref|XP_022997249.1| 40S ribosomal protein S6-like [Cucurbita max... 130 2e-34 ref|XP_022951611.1| 40S ribosomal protein S6-like [Cucurbita mos... 130 2e-34 ref|XP_002525831.2| PREDICTED: 40S ribosomal protein S6 [Ricinus... 130 2e-34 gb|KJB48852.1| hypothetical protein B456_008G090300 [Gossypium r... 128 2e-34 gb|KDO60704.1| hypothetical protein CISIN_1g025698mg [Citrus sin... 128 2e-34 gb|PHT93401.1| 40S ribosomal protein S6 [Capsicum annuum] 129 2e-34 ref|XP_016549553.1| PREDICTED: 40S ribosomal protein S6-like [Ca... 129 2e-34 ref|XP_017229534.1| PREDICTED: 40S ribosomal protein S6 [Daucus ... 129 2e-34 ref|XP_017237597.1| PREDICTED: 40S ribosomal protein S6-like [Da... 129 2e-34 >gb|PAL60604.1| hypothetical protein CEJ83_21460, partial [Acinetobacter baumannii] Length = 77 Score = 127 bits (319), Expect = 1e-35 Identities = 67/72 (93%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RI+EKKQRIAKAK+EAA+YQKLLA+RLKEQRERRSESLAKKRS Sbjct: 6 PKIQRLVTPLTLQRKRARISEKKQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRS 65 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 66 RLSAASKPSIAA 77 >ref|XP_022962357.1| 40S ribosomal protein S6-like [Cucurbita moschata] ref|XP_023547004.1| 40S ribosomal protein S6-like [Cucurbita pepo subsp. pepo] Length = 249 Score = 131 bits (330), Expect = 4e-35 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_022948606.1| 40S ribosomal protein S6 [Cucurbita moschata] ref|XP_022974831.1| 40S ribosomal protein S6 [Cucurbita maxima] ref|XP_023540275.1| 40S ribosomal protein S6 [Cucurbita pepo subsp. pepo] Length = 249 Score = 131 bits (330), Expect = 4e-35 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >gb|EEF36525.1| 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 130 bits (326), Expect = 4e-35 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KKQRIAKAKSEAADYQKLLA+RLKEQRERRSESLAKKRS Sbjct: 126 PKIQRLVTPLTLQRKRARIAQKKQRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRS 185 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 186 RLSAASKPSIAA 197 >ref|XP_008437828.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis melo] Length = 250 Score = 131 bits (330), Expect = 4e-35 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_004133785.1| PREDICTED: 40S ribosomal protein S6-like [Cucumis sativus] gb|KGN56379.1| hypothetical protein Csa_3G118140 [Cucumis sativus] Length = 250 Score = 131 bits (330), Expect = 4e-35 Identities = 70/72 (97%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_018848971.1| PREDICTED: 40S ribosomal protein S6-like, partial [Juglans regia] Length = 177 Score = 129 bits (324), Expect = 5e-35 Identities = 68/72 (94%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLA+RLKEQR+RRSESLAKKRS Sbjct: 106 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLATRLKEQRDRRSESLAKKRS 165 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 166 RLSAASKPSIAA 177 >ref|XP_022131886.1| 40S ribosomal protein S6 [Momordica charantia] Length = 249 Score = 131 bits (329), Expect = 6e-35 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPS+AA Sbjct: 238 RLSAASKPSVAA 249 >ref|XP_006355210.1| PREDICTED: 40S ribosomal protein S6-like [Solanum tuberosum] Length = 197 Score = 129 bits (325), Expect = 6e-35 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KK+RIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS Sbjct: 126 PKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 185 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 186 RLSAASKPSIAA 197 >gb|PKI39417.1| hypothetical protein CRG98_040175, partial [Punica granatum] Length = 78 Score = 125 bits (314), Expect = 8e-35 Identities = 65/72 (90%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KK+RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAKKRS Sbjct: 7 PKIQRLVTPLTLQRKRARIADKKKRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRS 66 Query: 279 RLSAASKPSIAA 244 RLSAASKPS+AA Sbjct: 67 RLSAASKPSVAA 78 >ref|XP_004152628.1| PREDICTED: 40S ribosomal protein S6 [Cucumis sativus] gb|KGN62705.1| hypothetical protein Csa_2G369060 [Cucumis sativus] Length = 249 Score = 130 bits (327), Expect = 1e-34 Identities = 69/72 (95%), Positives = 72/72 (100%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLL+SRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLSSRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_022997249.1| 40S ribosomal protein S6-like [Cucurbita maxima] Length = 249 Score = 130 bits (326), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLS ASKPSIAA Sbjct: 238 RLSTASKPSIAA 249 >ref|XP_022951611.1| 40S ribosomal protein S6-like [Cucurbita moschata] ref|XP_023002727.1| 40S ribosomal protein S6-like [Cucurbita maxima] ref|XP_023538404.1| 40S ribosomal protein S6-like [Cucurbita pepo subsp. pepo] Length = 249 Score = 130 bits (326), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRGRIAEKKKRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLS ASKPSIAA Sbjct: 238 RLSTASKPSIAA 249 >ref|XP_002525831.2| PREDICTED: 40S ribosomal protein S6 [Ricinus communis] Length = 249 Score = 130 bits (326), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KKQRIAKAKSEAADYQKLLA+RLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRARIAQKKQRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >gb|KJB48852.1| hypothetical protein B456_008G090300 [Gossypium raimondii] Length = 197 Score = 128 bits (322), Expect = 2e-34 Identities = 67/72 (93%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKRGRIAEKK+R+AKAK+EAA+YQKLLA RLKEQRERRSESLAKKRS Sbjct: 126 PKIQRLVTPLTLQRKRGRIAEKKKRVAKAKAEAAEYQKLLAQRLKEQRERRSESLAKKRS 185 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 186 RLSAASKPSIAA 197 >gb|KDO60704.1| hypothetical protein CISIN_1g025698mg [Citrus sinensis] gb|KDO60705.1| hypothetical protein CISIN_1g025698mg [Citrus sinensis] Length = 197 Score = 128 bits (322), Expect = 2e-34 Identities = 68/72 (94%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIAEKKQRIAKAK+EAA+YQKLLA+RLKEQRERRSESLAKKRS Sbjct: 126 PKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRS 185 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 186 RLSAASKPSIAA 197 >gb|PHT93401.1| 40S ribosomal protein S6 [Capsicum annuum] Length = 249 Score = 129 bits (325), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KK+RIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_016549553.1| PREDICTED: 40S ribosomal protein S6-like [Capsicum annuum] gb|PHT95888.1| 40S ribosomal protein S6 [Capsicum annuum] Length = 249 Score = 129 bits (325), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KK+RIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRARIADKKKRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_017229534.1| PREDICTED: 40S ribosomal protein S6 [Daucus carota subsp. sativus] gb|KZN10819.1| hypothetical protein DCAR_003475 [Daucus carota subsp. sativus] Length = 249 Score = 129 bits (325), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KKQRIAKAKSEAADYQKLLASRLKEQRE+RSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRARIAKKKQRIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249 >ref|XP_017237597.1| PREDICTED: 40S ribosomal protein S6-like [Daucus carota subsp. sativus] gb|KZN02914.1| hypothetical protein DCAR_011670 [Daucus carota subsp. sativus] Length = 249 Score = 129 bits (325), Expect = 2e-34 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = -3 Query: 459 PKIQRLVTPLTLQRKRGRIAEKKQRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRS 280 PKIQRLVTPLTLQRKR RIA+KKQRIAKAKSEAADYQKLLASRLKEQRE+RSESLAKKRS Sbjct: 178 PKIQRLVTPLTLQRKRARIAKKKQRIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRS 237 Query: 279 RLSAASKPSIAA 244 RLSAASKPSIAA Sbjct: 238 RLSAASKPSIAA 249