BLASTX nr result
ID: Acanthopanax21_contig00010729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00010729 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN07574.1| hypothetical protein DCAR_008411 [Daucus carota s... 64 2e-10 >gb|KZN07574.1| hypothetical protein DCAR_008411 [Daucus carota subsp. sativus] Length = 85 Score = 63.9 bits (154), Expect = 2e-10 Identities = 33/69 (47%), Positives = 40/69 (57%) Frame = +2 Query: 263 QYPGVPFLVIMVVLTFSQLSICRDIHRSXXXXXXXXXXXXFRTPFPSHFPAAAPVEAKSD 442 QY V FL IM++++F +LS CRDIHRS + FPS FPA APV + Sbjct: 4 QYLQVSFLFIMIMISFFELSNCRDIHRSTTEGTTTNMKPGSHSSFPSRFPAKAPVADSNP 63 Query: 443 GTDPIYGTS 469 TDPIYG S Sbjct: 64 QTDPIYGMS 72