BLASTX nr result
ID: Acanthopanax21_contig00010643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00010643 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV58277.1| hypothetical protein CFOL_v3_01811 [Cephalotus f... 59 2e-08 >dbj|GAV58277.1| hypothetical protein CFOL_v3_01811 [Cephalotus follicularis] Length = 102 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/48 (54%), Positives = 29/48 (60%) Frame = +3 Query: 87 MLNCCLWLYLHHRVWEEQGWEVMVHHNRHLWVEWGCLQCPHLACHQWA 230 ML+CCL LHH+ E W + HN H WV W CLQC ACHQWA Sbjct: 1 MLSCCLLHCLHHQCRE---WVEVSLHNHHQWVGWECLQCQLSACHQWA 45