BLASTX nr result
ID: Acanthopanax21_contig00010440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00010440 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022892961.1| uncharacterized protein LOC111407594 isoform... 80 1e-16 ref|XP_022892960.1| DET1- and DDB1-associated protein 1 isoform ... 80 1e-16 ref|XP_010658376.1| PREDICTED: DET1- and DDB1-associated protein... 79 4e-16 ref|XP_002278358.1| PREDICTED: DET1- and DDB1-associated protein... 79 4e-16 ref|XP_012086820.1| DET1- and DDB1-associated protein 1 isoform ... 76 3e-15 ref|XP_021668405.1| DET1- and DDB1-associated protein 1-like [He... 75 9e-15 ref|XP_021284642.1| uncharacterized protein LOC110416846 [Herran... 75 1e-14 gb|PON39904.1| Ubiquitin ligase, Det1/DDB1-complexing [Parasponi... 74 2e-14 ref|XP_017972327.1| PREDICTED: uncharacterized protein LOC108661... 73 5e-14 ref|XP_017232139.1| PREDICTED: DET1- and DDB1-associated protein... 73 5e-14 gb|EEF51248.1| conserved hypothetical protein [Ricinus communis] 72 6e-14 ref|XP_017231887.1| PREDICTED: DET1- and DDB1-associated protein... 73 7e-14 gb|OTF84817.1| hypothetical protein HannXRQ_Chr17g0533231 [Helia... 72 9e-14 ref|XP_002509861.2| PREDICTED: DET1- and DDB1-associated protein... 72 1e-13 ref|XP_016742891.1| PREDICTED: uncharacterized protein LOC107952... 72 2e-13 ref|XP_012470544.1| PREDICTED: uncharacterized protein LOC105788... 72 2e-13 gb|OMP06074.1| Ubiquitin ligase, Det1/DDB1-complexing [Corchorus... 70 3e-13 ref|XP_009389322.1| PREDICTED: DET1- and DDB1-associated protein... 71 4e-13 ref|XP_021671790.1| uncharacterized protein LOC110658470 isoform... 70 4e-13 ref|XP_021671789.1| uncharacterized protein LOC110658470 isoform... 70 5e-13 >ref|XP_022892961.1| uncharacterized protein LOC111407594 isoform X2 [Olea europaea var. sylvestris] Length = 94 Score = 79.7 bits (195), Expect = 1e-16 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSEAPL 315 I+S+AKNILLRHFY RAEEKLRPKRAASE+L+P+H KHPRAS+S++ L Sbjct: 46 ITSDAKNILLRHFYQRAEEKLRPKRAASENLSPEHANKHPRASSSDSSL 94 >ref|XP_022892960.1| DET1- and DDB1-associated protein 1 isoform X1 [Olea europaea var. sylvestris] Length = 98 Score = 79.7 bits (195), Expect = 1e-16 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSEAPL 315 I+S+AKNILLRHFY RAEEKLRPKRAASE+L+P+H KHPRAS+S++ L Sbjct: 50 ITSDAKNILLRHFYQRAEEKLRPKRAASENLSPEHANKHPRASSSDSSL 98 >ref|XP_010658376.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X2 [Vitis vinifera] Length = 94 Score = 78.6 bits (192), Expect = 4e-16 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSE 324 IS+E KNILLRHFY RAEEKLRPKRAASE LTP+H CK PRAS S+ Sbjct: 49 ISTETKNILLRHFYQRAEEKLRPKRAASEHLTPEHGCKQPRASASD 94 >ref|XP_002278358.1| PREDICTED: DET1- and DDB1-associated protein 1 isoform X1 [Vitis vinifera] emb|CBI34390.3| unnamed protein product, partial [Vitis vinifera] Length = 95 Score = 78.6 bits (192), Expect = 4e-16 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSE 324 IS+E KNILLRHFY RAEEKLRPKRAASE LTP+H CK PRAS S+ Sbjct: 50 ISTETKNILLRHFYQRAEEKLRPKRAASEHLTPEHGCKQPRASASD 95 >ref|XP_012086820.1| DET1- and DDB1-associated protein 1 isoform X1 [Jatropha curcas] gb|KDP25382.1| hypothetical protein JCGZ_20538 [Jatropha curcas] Length = 95 Score = 76.3 bits (186), Expect = 3e-15 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 IS+EAKNILLR+FY RAEE+LRPKRAASESL P+H CK PRASTS Sbjct: 50 ISTEAKNILLRNFYERAEERLRPKRAASESLIPEHGCKQPRASTS 94 >ref|XP_021668405.1| DET1- and DDB1-associated protein 1-like [Hevea brasiliensis] Length = 95 Score = 75.1 bits (183), Expect = 9e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNILLR+FY RAEEKLRPKRAASE+L P+H CK PRASTS Sbjct: 50 ITTEAKNILLRNFYERAEEKLRPKRAASENLIPEHGCKQPRASTS 94 >ref|XP_021284642.1| uncharacterized protein LOC110416846 [Herrania umbratica] Length = 94 Score = 74.7 bits (182), Expect = 1e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNIL+R+FY RAEEKLRPKRAA+E L PDH CK PRASTS Sbjct: 50 ITTEAKNILIRNFYQRAEEKLRPKRAATEHLIPDHGCKQPRASTS 94 >gb|PON39904.1| Ubiquitin ligase, Det1/DDB1-complexing [Parasponia andersonii] gb|PON97771.1| Ubiquitin ligase, Det1/DDB1-complexing [Trema orientalis] Length = 69 Score = 73.6 bits (179), Expect = 2e-14 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSE 324 +++E KNILLRH Y RAEEKLRPKRAASE L P+H CKHPRAS + Sbjct: 21 VTTETKNILLRHIYQRAEEKLRPKRAASEHLLPEHGCKHPRASIQD 66 >ref|XP_017972327.1| PREDICTED: uncharacterized protein LOC108661081 [Theobroma cacao] Length = 94 Score = 73.2 bits (178), Expect = 5e-14 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNIL+R+FY RAEEKLRPKRAA+E L P+H CK PRASTS Sbjct: 50 ITTEAKNILIRNFYQRAEEKLRPKRAATEHLIPEHGCKQPRASTS 94 >ref|XP_017232139.1| PREDICTED: DET1- and DDB1-associated protein 1-like [Daucus carota subsp. sativus] Length = 100 Score = 73.2 bits (178), Expect = 5e-14 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 2/51 (3%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAAS--ESLTPDHVCKHPRASTSEAPL 315 ISSEAKNILLRHFY R+EEKLR KR AS ESLTP+ V KHPR+STS+A L Sbjct: 50 ISSEAKNILLRHFYARSEEKLRSKRGASETESLTPEQVRKHPRSSTSDARL 100 >gb|EEF51248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 72.0 bits (175), Expect = 6e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNILLR+FY RAEEKLR KRAASE+L P+H CK PRASTS Sbjct: 21 ITTEAKNILLRNFYERAEEKLRTKRAASENLIPEHGCKQPRASTS 65 >ref|XP_017231887.1| PREDICTED: DET1- and DDB1-associated protein 1 [Daucus carota subsp. sativus] gb|KZN04736.1| hypothetical protein DCAR_005573 [Daucus carota subsp. sativus] Length = 98 Score = 72.8 bits (177), Expect = 7e-14 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSEAPL 315 ISSE KNILLRHFYMRAEEKL+ KRAAS+ L+P+ V KHPRAS S+ L Sbjct: 50 ISSEEKNILLRHFYMRAEEKLKSKRAASDKLSPEQVRKHPRASISKGHL 98 >gb|OTF84817.1| hypothetical protein HannXRQ_Chr17g0533231 [Helianthus annuus] Length = 66 Score = 71.6 bits (174), Expect = 9e-14 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 3/51 (5%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPR---ASTSEAP 318 ISSEAKNILLR FY R +EKLRPKRAA E+L+P+ CKHPR AS+SE P Sbjct: 15 ISSEAKNILLRQFYQRGDEKLRPKRAAPENLSPEQECKHPRASFASSSEPP 65 >ref|XP_002509861.2| PREDICTED: DET1- and DDB1-associated protein 1 [Ricinus communis] Length = 95 Score = 72.0 bits (175), Expect = 1e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNILLR+FY RAEEKLR KRAASE+L P+H CK PRASTS Sbjct: 50 ITTEAKNILLRNFYERAEEKLRTKRAASENLIPEHGCKQPRASTS 94 >ref|XP_016742891.1| PREDICTED: uncharacterized protein LOC107952124 isoform X2 [Gossypium hirsutum] ref|XP_017620731.1| PREDICTED: uncharacterized protein LOC108464960 isoform X2 [Gossypium arboreum] Length = 95 Score = 71.6 bits (174), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNIL+R+FY RAEEKLRPKRAA+E TP+H CK PRAST+ Sbjct: 51 ITTEAKNILIRNFYQRAEEKLRPKRAATEHPTPEHGCKQPRASTT 95 >ref|XP_012470544.1| PREDICTED: uncharacterized protein LOC105788280 isoform X1 [Gossypium raimondii] gb|KJB19126.1| hypothetical protein B456_003G085700 [Gossypium raimondii] gb|PPD88370.1| hypothetical protein GOBAR_DD14697 [Gossypium barbadense] Length = 97 Score = 71.6 bits (174), Expect = 2e-13 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNIL+R+FY RAEEKLRPKRAA+E TP+H CK PRAST+ Sbjct: 51 ITTEAKNILIRNFYQRAEEKLRPKRAATEHPTPEHGCKQPRASTT 95 >gb|OMP06074.1| Ubiquitin ligase, Det1/DDB1-complexing [Corchorus olitorius] Length = 64 Score = 70.1 bits (170), Expect = 3e-13 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRAST 330 I++EAKNIL+R+FY RAEEKLRPKRAA+E L PDH CK RAST Sbjct: 21 ITTEAKNILIRNFYQRAEEKLRPKRAATEHLIPDHGCKQARAST 64 >ref|XP_009389322.1| PREDICTED: DET1- and DDB1-associated protein 1-like [Musa acuminata subsp. malaccensis] Length = 99 Score = 70.9 bits (172), Expect = 4e-13 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTSE 324 ISSEA+NILLRHFY ++EEK RPKRAAS+ LTP+H CK PR + ++ Sbjct: 51 ISSEARNILLRHFYQKSEEKFRPKRAASDHLTPEHSCKQPRCAYTD 96 >ref|XP_021671790.1| uncharacterized protein LOC110658470 isoform X4 [Hevea brasiliensis] Length = 86 Score = 70.5 bits (171), Expect = 4e-13 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNILLR FY RAEEKLRPKRAASE+L +H CK PRASTS Sbjct: 41 ITTEAKNILLRKFYERAEEKLRPKRAASENLILEHGCKQPRASTS 85 >ref|XP_021671789.1| uncharacterized protein LOC110658470 isoform X3 [Hevea brasiliensis] Length = 95 Score = 70.5 bits (171), Expect = 5e-13 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -3 Query: 461 ISSEAKNILLRHFYMRAEEKLRPKRAASESLTPDHVCKHPRASTS 327 I++EAKNILLR FY RAEEKLRPKRAASE+L +H CK PRASTS Sbjct: 50 ITTEAKNILLRKFYERAEEKLRPKRAASENLILEHGCKQPRASTS 94