BLASTX nr result
ID: Acanthopanax21_contig00010360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00010360 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017244476.1| PREDICTED: calmodulin-binding protein 25-lik... 54 5e-06 >ref|XP_017244476.1| PREDICTED: calmodulin-binding protein 25-like [Daucus carota subsp. sativus] gb|KZM99115.1| hypothetical protein DCAR_013523 [Daucus carota subsp. sativus] Length = 216 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/44 (59%), Positives = 28/44 (63%) Frame = +3 Query: 3 AAGPTSTAIAQPGLGYTPPGLVAEGGDAGFDLESFSVFPTLESW 134 AA QP +GY G+ AEGG AGFD ESFS FPTLESW Sbjct: 170 AAANAPVMSQQPTMGYGTAGVAAEGGGAGFDFESFSGFPTLESW 213