BLASTX nr result
ID: Acanthopanax21_contig00010348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00010348 (657 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO43853.1| hypothetical protein CISIN_1g0409871mg, partial [... 84 6e-18 gb|PON75897.1| WD repeat containing protein [Parasponia andersonii] 86 8e-16 gb|PON79543.1| WD repeat containing protein [Trema orientalis] 85 3e-15 dbj|GAY37175.1| hypothetical protein CUMW_027030 [Citrus unshiu] 84 4e-15 ref|XP_006474199.1| PREDICTED: WD repeat-containing protein 75 [... 84 4e-15 gb|ESR66584.1| hypothetical protein CICLE_v10007405mg [Citrus cl... 84 4e-15 gb|PKI46390.1| hypothetical protein CRG98_033228, partial [Punic... 80 5e-15 emb|CAN69125.1| hypothetical protein VITISV_008194 [Vitis vinifera] 80 5e-14 ref|XP_023900086.1| WD repeat-containing protein 75 [Quercus sub... 80 7e-14 ref|XP_002266770.1| PREDICTED: WD repeat-containing protein 75 i... 80 7e-14 ref|XP_010660305.1| PREDICTED: WD repeat-containing protein 75 i... 80 7e-14 gb|OWM87006.1| hypothetical protein CDL15_Pgr016043 [Punica gran... 80 1e-13 gb|POE51078.1| hypothetical protein CFP56_68541 [Quercus suber] 74 1e-13 ref|XP_002533224.1| PREDICTED: WD repeat-containing protein 75 [... 80 1e-13 ref|XP_010094219.1| WD repeat-containing protein 75 [Morus notab... 79 3e-13 gb|OMO71724.1| hypothetical protein CCACVL1_18085 [Corchorus cap... 79 3e-13 ref|XP_018850745.1| PREDICTED: WD repeat-containing protein 75 [... 79 3e-13 gb|KJB53782.1| hypothetical protein B456_009G004800 [Gossypium r... 78 6e-13 gb|OMO60725.1| hypothetical protein CCACVL1_23917 [Corchorus cap... 78 6e-13 ref|XP_016690381.1| PREDICTED: WD repeat-containing protein 75 [... 78 6e-13 >gb|KDO43853.1| hypothetical protein CISIN_1g0409871mg, partial [Citrus sinensis] Length = 67 Score = 84.3 bits (207), Expect = 6e-18 Identities = 44/57 (77%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFKLK N A PSE+PWETIFSGSSHNLP LTKLCS FLES LEKRTA LE Sbjct: 11 LPEFKLKRNQDLWAPSVPSEKPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAALE 67 >gb|PON75897.1| WD repeat containing protein [Parasponia andersonii] Length = 813 Score = 86.3 bits (212), Expect = 8e-16 Identities = 44/57 (77%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFKLK N A PSERPWETIFSGSSHNLP LTKLCS FLES LEKRTA++E Sbjct: 757 LPEFKLKGNQNLLAPSGPSERPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAIVE 813 >gb|PON79543.1| WD repeat containing protein [Trema orientalis] Length = 814 Score = 84.7 bits (208), Expect = 3e-15 Identities = 43/57 (75%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF+LK N A PSERPWETIFSGSSHNLP LTKLCS FLES LEKRTA++E Sbjct: 758 LPEFELKRNQNLLAPSGPSERPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAIVE 814 >dbj|GAY37175.1| hypothetical protein CUMW_027030 [Citrus unshiu] Length = 818 Score = 84.3 bits (207), Expect = 4e-15 Identities = 44/57 (77%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFKLK N A PSE+PWETIFSGSSHNLP LTKLCS FLES LEKRTA LE Sbjct: 762 LPEFKLKRNQDLWAPSVPSEKPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAALE 818 >ref|XP_006474199.1| PREDICTED: WD repeat-containing protein 75 [Citrus sinensis] ref|XP_024033296.1| WD repeat-containing protein 75 [Citrus clementina] Length = 818 Score = 84.3 bits (207), Expect = 4e-15 Identities = 44/57 (77%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFKLK N A PSE+PWETIFSGSSHNLP LTKLCS FLES LEKRTA LE Sbjct: 762 LPEFKLKRNQDLWAPSVPSEKPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAALE 818 >gb|ESR66584.1| hypothetical protein CICLE_v10007405mg [Citrus clementina] Length = 888 Score = 84.3 bits (207), Expect = 4e-15 Identities = 44/57 (77%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFKLK N A PSE+PWETIFSGSSHNLP LTKLCS FLES LEKRTA LE Sbjct: 832 LPEFKLKRNQDLWAPSVPSEKPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAALE 888 >gb|PKI46390.1| hypothetical protein CRG98_033228, partial [Punica granatum] Length = 189 Score = 80.1 bits (196), Expect = 5e-15 Identities = 40/59 (67%), Positives = 46/59 (77%), Gaps = 3/59 (5%) Frame = -3 Query: 655 LPEFKLKNPTQSAS---LEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF LK ++A+ + PSERPWETIFSGSSHNLP LTKLC+ FLES LEKR A +E Sbjct: 129 LPEFDLKKSQKAAAEAVVVPSERPWETIFSGSSHNLPPLTKLCAAFLESLLEKRPAAVE 187 >emb|CAN69125.1| hypothetical protein VITISV_008194 [Vitis vinifera] Length = 407 Score = 80.5 bits (197), Expect = 5e-14 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVL 491 LPEF K N T+ A L PSE+PWETIF GSSHNLP +TKLCS FLES LEKRT V+ Sbjct: 350 LPEFDAKRNQTELAPLLPSEKPWETIFCGSSHNLPPITKLCSAFLESLLEKRTPVI 405 >ref|XP_023900086.1| WD repeat-containing protein 75 [Quercus suber] gb|POE51079.1| wd repeat-containing protein 75 [Quercus suber] Length = 803 Score = 80.5 bits (197), Expect = 7e-14 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -3 Query: 655 LPEFKLKNPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEFK +N T PSERPWETIFSGSSHNLP LT+LC+ FLES +EKRTA +E Sbjct: 749 LPEFK-RNQTSLVPSVPSERPWETIFSGSSHNLPPLTRLCAAFLESLMEKRTAAVE 803 >ref|XP_002266770.1| PREDICTED: WD repeat-containing protein 75 isoform X2 [Vitis vinifera] emb|CBI33488.3| unnamed protein product, partial [Vitis vinifera] Length = 815 Score = 80.5 bits (197), Expect = 7e-14 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVL 491 LPEF K N T+ A L PSE+PWETIF GSSHNLP +TKLCS FLES LEKRT V+ Sbjct: 758 LPEFDAKRNQTELAPLLPSEKPWETIFCGSSHNLPPITKLCSAFLESLLEKRTPVI 813 >ref|XP_010660305.1| PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] ref|XP_010660306.1| PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] ref|XP_010660307.1| PREDICTED: WD repeat-containing protein 75 isoform X1 [Vitis vinifera] Length = 816 Score = 80.5 bits (197), Expect = 7e-14 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 655 LPEFKLK-NPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVL 491 LPEF K N T+ A L PSE+PWETIF GSSHNLP +TKLCS FLES LEKRT V+ Sbjct: 759 LPEFDAKRNQTELAPLLPSEKPWETIFCGSSHNLPPITKLCSAFLESLLEKRTPVI 814 >gb|OWM87006.1| hypothetical protein CDL15_Pgr016043 [Punica granatum] Length = 785 Score = 80.1 bits (196), Expect = 1e-13 Identities = 40/59 (67%), Positives = 46/59 (77%), Gaps = 3/59 (5%) Frame = -3 Query: 655 LPEFKLKNPTQSAS---LEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF LK ++A+ + PSERPWETIFSGSSHNLP LTKLC+ FLES LEKR A +E Sbjct: 725 LPEFDLKKSQKAAAEAVVVPSERPWETIFSGSSHNLPPLTKLCAAFLESLLEKRPAAVE 783 >gb|POE51078.1| hypothetical protein CFP56_68541 [Quercus suber] Length = 79 Score = 73.6 bits (179), Expect = 1e-13 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +3 Query: 486 HSNTAVLFSRNDSRNTEHNLVREGRLCDDPLKIVSQGRSDGSSEAD*VGFFNLNSGS 656 HS AVLFS NDSRN HNLVR GRLCDDPL IVSQG SDG+ + V +F LNSG+ Sbjct: 22 HSTAAVLFSINDSRNAAHNLVRGGRLCDDPLNIVSQGLSDGTDGTNEV-WFLLNSGN 77 >ref|XP_002533224.1| PREDICTED: WD repeat-containing protein 75 [Ricinus communis] gb|EEF29164.1| wd40 protein, putative [Ricinus communis] Length = 807 Score = 79.7 bits (195), Expect = 1e-13 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKL-KNPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF K S PSERPW+TIFSGSSHNLP LTKLCS FLES LEKRT+V+E Sbjct: 751 LPEFDFTKTQASSVPSVPSERPWDTIFSGSSHNLPPLTKLCSAFLESLLEKRTSVVE 807 >ref|XP_010094219.1| WD repeat-containing protein 75 [Morus notabilis] gb|EXB55395.1| WD repeat-containing protein 75 [Morus notabilis] Length = 815 Score = 79.0 bits (193), Expect = 3e-13 Identities = 40/58 (68%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -3 Query: 655 LPEFKLKNPTQS--ASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF+LK Q+ A PS RPWETIFSGSSHNLP LTKLCS FLES LE+RT +E Sbjct: 758 LPEFELKKTNQNLLAPSVPSGRPWETIFSGSSHNLPPLTKLCSAFLESLLERRTPTVE 815 >gb|OMO71724.1| hypothetical protein CCACVL1_18085 [Corchorus capsularis] Length = 789 Score = 78.6 bits (192), Expect = 3e-13 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = -3 Query: 655 LPEFKLKNPTQSASLE--PSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF +K TQS+ + PSERPWETIFSGSSH LP LTKLCS FLES LEKRTA +E Sbjct: 733 LPEFDMKR-TQSSWVPSFPSERPWETIFSGSSHALPPLTKLCSAFLESLLEKRTAAVE 789 >ref|XP_018850745.1| PREDICTED: WD repeat-containing protein 75 [Juglans regia] Length = 813 Score = 78.6 bits (192), Expect = 3e-13 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKL-KNPTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LP+ L +N T PSERPWE+IFSGSSHNLP LTKLCS FLES +EKRTAV+E Sbjct: 757 LPKLNLTRNQTSLVPSVPSERPWESIFSGSSHNLPPLTKLCSAFLESLMEKRTAVVE 813 >gb|KJB53782.1| hypothetical protein B456_009G004800 [Gossypium raimondii] Length = 797 Score = 77.8 bits (190), Expect = 6e-13 Identities = 40/57 (70%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLKNPTQS-ASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF K P PS+RPWETIFSGSSHNLP LTKLCS FLES LEKRTA E Sbjct: 741 LPEFDRKRPEAPWVPSFPSDRPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAAAE 797 >gb|OMO60725.1| hypothetical protein CCACVL1_23917 [Corchorus capsularis] Length = 810 Score = 77.8 bits (190), Expect = 6e-13 Identities = 39/57 (68%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLKN-PTQSASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPE+ +K P PSERPWETIFSGSSH LP LTKLCS FLES LEKRTA +E Sbjct: 754 LPEYDMKRTPNSRVPSFPSERPWETIFSGSSHALPPLTKLCSAFLESLLEKRTAAVE 810 >ref|XP_016690381.1| PREDICTED: WD repeat-containing protein 75 [Gossypium hirsutum] Length = 812 Score = 77.8 bits (190), Expect = 6e-13 Identities = 40/57 (70%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -3 Query: 655 LPEFKLKNPTQS-ASLEPSERPWETIFSGSSHNLPSLTKLCSVFLESFLEKRTAVLE 488 LPEF K P PS+RPWETIFSGSSHNLP LTKLCS FLES LEKRTA E Sbjct: 756 LPEFDRKRPEAPWVPSFPSDRPWETIFSGSSHNLPPLTKLCSAFLESLLEKRTAAAE 812