BLASTX nr result
ID: Acanthopanax21_contig00009981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00009981 (899 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017243444.1| PREDICTED: uncharacterized protein LOC108215... 59 3e-06 >ref|XP_017243444.1| PREDICTED: uncharacterized protein LOC108215449 [Daucus carota subsp. sativus] gb|KZN01490.1| hypothetical protein DCAR_010245 [Daucus carota subsp. sativus] Length = 443 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 108 MEVNLPSGNMIRGMGSYGGSLDLQGSIRVHHHQQP 4 ME NL SG+M+ GMGSYGG LDLQGS+RVHHHQQP Sbjct: 1 MEGNLQSGSML-GMGSYGGGLDLQGSMRVHHHQQP 34