BLASTX nr result
ID: Acanthopanax21_contig00009911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00009911 (831 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO75205.1| hypothetical protein CCACVL1_16302 [Corchorus cap... 45 7e-06 >gb|OMO75205.1| hypothetical protein CCACVL1_16302 [Corchorus capsularis] Length = 3040 Score = 45.1 bits (105), Expect(3) = 7e-06 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -1 Query: 486 KKR*PTMGANLWSYTGGPKTVIYDND-GQPVGGDANKLTTFIARLARNGEFFPISTPSWS 310 K R PT NL G I N+ GQPVG A L+ F+ ++A++G P+S +W Sbjct: 2687 KTRLPTQDHNLLDSLDGEPIFIPTNELGQPVGPKATMLSKFLGKIAKDGHLAPLSYITWR 2746 Query: 309 NMNESFMQRAW 277 M + ++ W Sbjct: 2747 KMPKEAREKMW 2757 Score = 29.6 bits (65), Expect(3) = 7e-06 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -3 Query: 271 NTANTSNND---RVNPTQWDALVDYWLSDDAQ 185 NT ND V P QW ALV YW SD A+ Sbjct: 2798 NTDEERLNDCHPSVLPDQWQALVSYWNSDKAK 2829 Score = 23.1 bits (48), Expect(3) = 7e-06 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 81 GKEVDRADMYTKSYTRGD 28 GKE RA++Y ++TR D Sbjct: 2867 GKEPSRAELYILTHTRKD 2884