BLASTX nr result
ID: Acanthopanax21_contig00008164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00008164 (647 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021849052.1| small ubiquitin-related modifier 1 [Spinacia... 87 8e-19 ref|XP_023920843.1| small ubiquitin-related modifier 1-like [Que... 87 9e-19 ref|XP_010252550.1| PREDICTED: small ubiquitin-related modifier ... 87 1e-18 gb|PON84490.1| E3 ubiquitin-protein ligase parkin [Trema orienta... 87 2e-18 gb|PON41636.1| E3 ubiquitin-protein ligase parkin [Parasponia an... 87 2e-18 emb|CAI11094.1| ubiquitin-like protein SMT3, partial [Cannabis s... 86 2e-18 ref|XP_022970791.1| small ubiquitin-related modifier 1-like [Cuc... 87 2e-18 ref|XP_022947043.1| small ubiquitin-related modifier 1-like [Cuc... 87 2e-18 gb|POE57567.1| small ubiquitin-related modifier 2 [Quercus suber] 86 2e-18 ref|XP_009802320.1| PREDICTED: small ubiquitin-related modifier ... 86 2e-18 gb|ACJ54186.1| SUMO [Nicotiana benthamiana] 86 2e-18 gb|PNX90846.1| small ubiquitin-related modifier 2-like protein, ... 86 2e-18 ref|XP_018812104.1| PREDICTED: small ubiquitin-related modifier ... 86 2e-18 ref|XP_008230020.1| PREDICTED: small ubiquitin-related modifier ... 86 2e-18 dbj|GAV85879.1| Rad60-SLD domain-containing protein [Cephalotus ... 86 2e-18 ref|XP_004251532.1| PREDICTED: small ubiquitin-related modifier ... 86 2e-18 ref|XP_004304088.1| PREDICTED: small ubiquitin-related modifier ... 86 2e-18 ref|XP_019434052.1| PREDICTED: small ubiquitin-related modifier ... 86 3e-18 ref|XP_019461175.1| PREDICTED: small ubiquitin-related modifier ... 86 3e-18 gb|OTG31532.1| putative rad60/SUMO-like domain, Ubiquitin-relate... 86 3e-18 >ref|XP_021849052.1| small ubiquitin-related modifier 1 [Spinacia oleracea] gb|KNA04684.1| hypothetical protein SOVF_197390 [Spinacia oleracea] Length = 97 Score = 87.4 bits (215), Expect = 8e-19 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 VE+NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA I Sbjct: 54 VELNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAMI 97 >ref|XP_023920843.1| small ubiquitin-related modifier 1-like [Quercus suber] gb|POE99911.1| small ubiquitin-related modifier 2 [Quercus suber] Length = 100 Score = 87.4 bits (215), Expect = 9e-19 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 131 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG T Sbjct: 57 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGTT 99 >ref|XP_010252550.1| PREDICTED: small ubiquitin-related modifier 1 [Nelumbo nucifera] Length = 98 Score = 87.0 bits (214), Expect = 1e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLR EQTPDELEMEDGDEIDAMLHQTGGATI Sbjct: 55 VDLNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGATI 98 >gb|PON84490.1| E3 ubiquitin-protein ligase parkin [Trema orientalis] Length = 101 Score = 86.7 bits (213), Expect = 2e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 VE NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA++ Sbjct: 57 VEFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGASL 100 >gb|PON41636.1| E3 ubiquitin-protein ligase parkin [Parasponia andersonii] Length = 101 Score = 86.7 bits (213), Expect = 2e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 VE NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA++ Sbjct: 57 VEFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGASL 100 >emb|CAI11094.1| ubiquitin-like protein SMT3, partial [Cannabis sativa] Length = 76 Score = 85.9 bits (211), Expect = 2e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 131 VE NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA+ Sbjct: 32 VEFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAS 74 >ref|XP_022970791.1| small ubiquitin-related modifier 1-like [Cucurbita maxima] ref|XP_023533825.1| small ubiquitin-related modifier 1-like [Cucurbita pepo subsp. pepo] Length = 108 Score = 86.7 bits (213), Expect = 2e-18 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+T+ Sbjct: 57 VDLNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSTL 100 >ref|XP_022947043.1| small ubiquitin-related modifier 1-like [Cucurbita moschata] Length = 108 Score = 86.7 bits (213), Expect = 2e-18 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+T+ Sbjct: 57 VDLNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSTL 100 >gb|POE57567.1| small ubiquitin-related modifier 2 [Quercus suber] Length = 83 Score = 85.9 bits (211), Expect = 2e-18 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 131 V+I+SIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT Sbjct: 40 VDISSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAT 82 >ref|XP_009802320.1| PREDICTED: small ubiquitin-related modifier 2 [Nicotiana sylvestris] ref|XP_016475002.1| PREDICTED: small ubiquitin-related modifier 2 [Nicotiana tabacum] ref|XP_019250239.1| PREDICTED: small ubiquitin-related modifier 2 isoform X2 [Nicotiana attenuata] Length = 96 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V+ NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+T+ Sbjct: 53 VDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSTV 96 >gb|ACJ54186.1| SUMO [Nicotiana benthamiana] Length = 96 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V+ NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG+T+ Sbjct: 53 VDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGSTV 96 >gb|PNX90846.1| small ubiquitin-related modifier 2-like protein, partial [Trifolium pratense] Length = 72 Score = 85.5 bits (210), Expect = 2e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA + Sbjct: 28 VDLNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGALL 71 >ref|XP_018812104.1| PREDICTED: small ubiquitin-related modifier 1 [Juglans regia] Length = 98 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 128 VE+NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 55 VELNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 96 >ref|XP_008230020.1| PREDICTED: small ubiquitin-related modifier 1-like [Prunus mume] ref|XP_008230021.1| PREDICTED: small ubiquitin-related modifier 1-like [Prunus mume] ref|XP_020415055.1| small ubiquitin-related modifier 1 [Prunus persica] ref|XP_021831458.1| small ubiquitin-related modifier 1-like [Prunus avium] gb|ONI18349.1| hypothetical protein PRUPE_3G210800 [Prunus persica] Length = 98 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 128 VE+NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 54 VELNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 95 >dbj|GAV85879.1| Rad60-SLD domain-containing protein [Cephalotus follicularis] Length = 99 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 128 VE+NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 55 VELNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 96 >ref|XP_004251532.1| PREDICTED: small ubiquitin-related modifier 1 [Solanum lycopersicum] ref|XP_015061649.1| PREDICTED: small ubiquitin-related modifier 1-like [Solanum pennellii] Length = 99 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V+ NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG TI Sbjct: 56 VDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGTTI 99 >ref|XP_004304088.1| PREDICTED: small ubiquitin-related modifier 1-like [Fragaria vesca subsp. vesca] ref|XP_024179734.1| small ubiquitin-related modifier 1-like [Rosa chinensis] gb|PRQ52683.1| putative Rad60/SUMO-like domain-containing protein [Rosa chinensis] Length = 101 Score = 86.3 bits (212), Expect = 2e-18 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 128 VE+NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA Sbjct: 57 VELNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA 98 >ref|XP_019434052.1| PREDICTED: small ubiquitin-related modifier 1-like [Lupinus angustifolius] gb|OIW16235.1| hypothetical protein TanjilG_18950 [Lupinus angustifolius] Length = 102 Score = 86.3 bits (212), Expect = 3e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA I Sbjct: 58 VDLNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGALI 101 >ref|XP_019461175.1| PREDICTED: small ubiquitin-related modifier 1-like [Lupinus angustifolius] gb|OIW02763.1| hypothetical protein TanjilG_29539 [Lupinus angustifolius] Length = 102 Score = 86.3 bits (212), Expect = 3e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGATI 134 V++NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGA I Sbjct: 58 VDLNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGAPI 101 >gb|OTG31532.1| putative rad60/SUMO-like domain, Ubiquitin-related domain protein [Helianthus annuus] gb|OTG31536.1| putative rad60/SUMO-like domain, Ubiquitin-related domain protein [Helianthus annuus] Length = 79 Score = 85.5 bits (210), Expect = 3e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 125 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG Sbjct: 30 VEINSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGG 70