BLASTX nr result
ID: Acanthopanax21_contig00007874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00007874 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017254845.1| PREDICTED: cystinosin homolog [Daucus carota... 56 3e-06 >ref|XP_017254845.1| PREDICTED: cystinosin homolog [Daucus carota subsp. sativus] gb|KZM90882.1| hypothetical protein DCAR_021753 [Daucus carota subsp. sativus] Length = 274 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +2 Query: 2 QHYVIYPAKKTVESPNLDVVSKEPLVESSDHPRSADV 112 QHYV+YP K+ +SP +DVVSKEPL+ESS++P + DV Sbjct: 238 QHYVLYPEKRRAKSPTVDVVSKEPLIESSENPHTEDV 274