BLASTX nr result
ID: Acanthopanax21_contig00007353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00007353 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017242157.1| PREDICTED: uncharacterized protein LOC108214... 62 8e-08 >ref|XP_017242157.1| PREDICTED: uncharacterized protein LOC108214587 [Daucus carota subsp. sativus] ref|XP_017242158.1| PREDICTED: uncharacterized protein LOC108214587 [Daucus carota subsp. sativus] Length = 611 Score = 61.6 bits (148), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 32 PFTGEPYKFDPFTGELIRPESPLRHFRSPY 121 P+TGEPYKFDPFTGE IRPESP R+FRSPY Sbjct: 582 PYTGEPYKFDPFTGEPIRPESPQRNFRSPY 611