BLASTX nr result
ID: Acanthopanax21_contig00007043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00007043 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554728.1| monothiol glutaredoxin-S7, chloroplastic iso... 81 1e-16 ref|XP_013449360.1| Grx4 family monothiol glutaredoxin [Medicago... 79 6e-16 pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 78 1e-15 gb|ABR26131.1| osgrx_s14 - glutaredoxin subgroup ii, partial [Or... 77 2e-15 ref|XP_006652025.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 77 3e-15 gb|EMS55349.1| Monothiol glutaredoxin-S7, chloroplastic [Triticu... 77 3e-15 gb|OEL18833.1| Monothiol glutaredoxin-S7, chloroplastic [Dichant... 78 4e-15 ref|XP_015570965.1| PREDICTED: uncharacterized monothiol glutare... 78 4e-15 ref|XP_003559141.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 78 4e-15 ref|XP_019052478.1| PREDICTED: monothiol glutaredoxin-S14, chlor... 76 4e-15 gb|PAN43987.1| hypothetical protein PAHAL_I01106 [Panicum hallii] 78 4e-15 ref|XP_004981028.1| monothiol glutaredoxin-S7, chloroplastic iso... 78 4e-15 gb|PIN24235.1| Glutaredoxin [Handroanthus impetiginosus] 78 5e-15 ref|XP_011033719.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 78 5e-15 gb|ACN28168.1| unknown [Zea mays] >gi|1142642555|gb|ONM11618.1| ... 78 5e-15 gb|ACG38305.1| Grx_S14 - glutaredoxin subgroup II [Zea mays] 78 5e-15 ref|NP_001150229.2| Grx_S14 - glutaredoxin subgroup II [Zea mays... 78 5e-15 ref|XP_002466093.1| monothiol glutaredoxin-S7, chloroplastic [So... 78 5e-15 ref|XP_016484933.1| PREDICTED: uncharacterized monothiol glutare... 78 5e-15 ref|XP_009779743.1| PREDICTED: monothiol glutaredoxin-S7, chloro... 78 5e-15 >ref|XP_020554728.1| monothiol glutaredoxin-S7, chloroplastic isoform X2 [Sesamum indicum] Length = 129 Score = 81.3 bits (199), Expect = 1e-16 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 27 TSPKGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 TS KGLKEYSSWPTFPQLYIDG+FFGGCDIT+EAYKSG Sbjct: 80 TSHKGLKEYSSWPTFPQLYIDGDFFGGCDITVEAYKSG 117 >ref|XP_013449360.1| Grx4 family monothiol glutaredoxin [Medicago truncatula] gb|KEH23388.1| Grx4 family monothiol glutaredoxin [Medicago truncatula] Length = 131 Score = 79.3 bits (194), Expect = 6e-16 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 27 TSPKGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 T KGLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYK+G Sbjct: 82 TLDKGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKNG 119 >pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 Score = 78.2 bits (191), Expect = 1e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 63 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 97 >gb|ABR26131.1| osgrx_s14 - glutaredoxin subgroup ii, partial [Oryza sativa Indica Group] Length = 89 Score = 77.0 bits (188), Expect = 2e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT++AYKSG Sbjct: 43 QGLKEYSSWPTFPQLYIDGEFFGGCDITVDAYKSG 77 >ref|XP_006652025.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic, partial [Oryza brachyantha] Length = 115 Score = 77.0 bits (188), Expect = 3e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYK+G Sbjct: 69 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKNG 103 >gb|EMS55349.1| Monothiol glutaredoxin-S7, chloroplastic [Triticum urartu] Length = 103 Score = 76.6 bits (187), Expect = 3e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLK+YSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 57 QGLKDYSSWPTFPQLYIDGEFFGGCDITLEAYKSG 91 >gb|OEL18833.1| Monothiol glutaredoxin-S7, chloroplastic [Dichanthelium oligosanthes] Length = 169 Score = 78.2 bits (191), Expect = 4e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 123 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 157 >ref|XP_015570965.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Ricinus communis] ref|XP_015570966.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Ricinus communis] Length = 169 Score = 78.2 bits (191), Expect = 4e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 123 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 157 >ref|XP_003559141.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Brachypodium distachyon] gb|KQK12089.1| hypothetical protein BRADI_1g01570v3 [Brachypodium distachyon] Length = 169 Score = 78.2 bits (191), Expect = 4e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 123 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 157 >ref|XP_019052478.1| PREDICTED: monothiol glutaredoxin-S14, chloroplastic [Nelumbo nucifera] Length = 86 Score = 75.9 bits (185), Expect = 4e-15 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYS+WPTFPQLYIDGEFFGGCDIT+EAYK+G Sbjct: 40 QGLKEYSNWPTFPQLYIDGEFFGGCDITVEAYKNG 74 >gb|PAN43987.1| hypothetical protein PAHAL_I01106 [Panicum hallii] Length = 171 Score = 78.2 bits (191), Expect = 4e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 125 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 159 >ref|XP_004981028.1| monothiol glutaredoxin-S7, chloroplastic isoform X1 [Setaria italica] gb|KQK86151.1| hypothetical protein SETIT_037775mg [Setaria italica] Length = 171 Score = 78.2 bits (191), Expect = 4e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 125 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 159 >gb|PIN24235.1| Glutaredoxin [Handroanthus impetiginosus] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >ref|XP_011033719.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Populus euphratica] ref|XP_011033720.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Populus euphratica] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >gb|ACN28168.1| unknown [Zea mays] gb|ONM11618.1| Monothiol glutaredoxin-S14 chloroplastic [Zea mays] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >gb|ACG38305.1| Grx_S14 - glutaredoxin subgroup II [Zea mays] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >ref|NP_001150229.2| Grx_S14 - glutaredoxin subgroup II [Zea mays] gb|AQK61572.1| Monothiol glutaredoxin-S14 chloroplastic [Zea mays] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >ref|XP_002466093.1| monothiol glutaredoxin-S7, chloroplastic [Sorghum bicolor] gb|EER93091.1| hypothetical protein SORBI_3001G010900 [Sorghum bicolor] Length = 172 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 126 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 160 >ref|XP_016484933.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Nicotiana tabacum] Length = 175 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 129 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 163 >ref|XP_009779743.1| PREDICTED: monothiol glutaredoxin-S7, chloroplastic [Nicotiana sylvestris] ref|XP_016472352.1| PREDICTED: uncharacterized monothiol glutaredoxin ycf64-like [Nicotiana tabacum] Length = 175 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 36 KGLKEYSSWPTFPQLYIDGEFFGGCDITIEAYKSG 140 +GLKEYSSWPTFPQLYIDGEFFGGCDIT+EAYKSG Sbjct: 129 QGLKEYSSWPTFPQLYIDGEFFGGCDITVEAYKSG 163