BLASTX nr result
ID: Acanthopanax21_contig00006808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00006808 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017247775.1| PREDICTED: ACT domain-containing protein ACR... 81 5e-15 ref|XP_017247774.1| PREDICTED: ACT domain-containing protein ACR... 81 5e-15 dbj|GAV92123.1| ACT domain-containing protein, partial [Cephalot... 69 7e-11 dbj|GAV64250.1| ACT domain-containing protein [Cephalotus follic... 69 7e-11 ref|XP_020239316.1| ACT domain-containing protein ACR6-like [Caj... 67 3e-10 ref|XP_003622132.2| four ACT domain ACT domain protein which pro... 67 4e-10 ref|XP_003622131.1| four ACT domain ACT domain protein which pro... 67 5e-10 ref|XP_023923274.1| ACT domain-containing protein ACR6 [Quercus ... 67 5e-10 gb|ABQ53997.1| unknown protein, partial [Cicer arietinum] 62 9e-10 ref|XP_021609576.1| ACT domain-containing protein ACR6 [Manihot ... 65 2e-09 gb|OAY52498.1| hypothetical protein MANES_04G088400 [Manihot esc... 65 2e-09 gb|OVA17453.1| ACT domain [Macleaya cordata] 65 2e-09 gb|KHN02059.1| [Protein-PII] uridylyltransferase [Glycine soja] 65 2e-09 gb|ONI19979.1| hypothetical protein PRUPE_3G308800 [Prunus persica] 64 3e-09 gb|ONI19980.1| hypothetical protein PRUPE_3G308800 [Prunus persica] 64 3e-09 gb|ONI19977.1| hypothetical protein PRUPE_3G308800 [Prunus persica] 64 3e-09 ref|XP_015893954.1| PREDICTED: ACT domain-containing protein ACR... 64 3e-09 ref|XP_007215389.1| ACT domain-containing protein ACR6 [Prunus p... 64 3e-09 gb|ONI19975.1| hypothetical protein PRUPE_3G308800 [Prunus persica] 64 3e-09 gb|KRG94579.1| hypothetical protein GLYMA_19G095400 [Glycine max] 64 4e-09 >ref|XP_017247775.1| PREDICTED: ACT domain-containing protein ACR6 isoform X2 [Daucus carota subsp. sativus] gb|KZM98144.1| hypothetical protein DCAR_014494 [Daucus carota subsp. sativus] Length = 443 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 LHVRQN+SNSP PPQEKTISFLFGNLFKARTF N KLIRSYS Sbjct: 402 LHVRQNTSNSPTPPQEKTISFLFGNLFKARTFHNLKLIRSYS 443 >ref|XP_017247774.1| PREDICTED: ACT domain-containing protein ACR6 isoform X1 [Daucus carota subsp. sativus] Length = 446 Score = 80.9 bits (198), Expect = 5e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 LHVRQN+SNSP PPQEKTISFLFGNLFKARTF N KLIRSYS Sbjct: 405 LHVRQNTSNSPTPPQEKTISFLFGNLFKARTFHNLKLIRSYS 446 >dbj|GAV92123.1| ACT domain-containing protein, partial [Cephalotus follicularis] Length = 439 Score = 68.9 bits (167), Expect = 7e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 L +R NS+ +P PPQE T+ +LFGNLFKARTFQNFKLIRSYS Sbjct: 398 LRIRHNSTVAPEPPQETTMGYLFGNLFKARTFQNFKLIRSYS 439 >dbj|GAV64250.1| ACT domain-containing protein [Cephalotus follicularis] Length = 456 Score = 68.9 bits (167), Expect = 7e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 L +R NS+ +P PPQE T+ +LFGNLFKARTFQNFKLIRSYS Sbjct: 415 LRIRHNSTVAPEPPQETTMGYLFGNLFKARTFQNFKLIRSYS 456 >ref|XP_020239316.1| ACT domain-containing protein ACR6-like [Cajanus cajan] gb|KYP42633.1| [Protein-PII] uridylyltransferase [Cajanus cajan] Length = 447 Score = 67.4 bits (163), Expect = 3e-10 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+QNSS SP PQ TI FLFGN FKAR+FQNFKLIRSYS Sbjct: 405 VLKVKQNSSLSPKAPQPTTIGFLFGNFFKARSFQNFKLIRSYS 447 >ref|XP_003622132.2| four ACT domain ACT domain protein which protein [Medicago truncatula] gb|AES78350.2| four ACT domain ACT domain protein which protein [Medicago truncatula] Length = 339 Score = 66.6 bits (161), Expect = 4e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NSS SP PPQ TI FLFG+ FKAR+FQNFKLIRSYS Sbjct: 297 VLQVKHNSSLSPKPPQGTTIGFLFGSFFKARSFQNFKLIRSYS 339 >ref|XP_003622131.1| four ACT domain ACT domain protein which protein [Medicago truncatula] gb|AES78349.1| four ACT domain ACT domain protein which protein [Medicago truncatula] Length = 442 Score = 66.6 bits (161), Expect = 5e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NSS SP PPQ TI FLFG+ FKAR+FQNFKLIRSYS Sbjct: 400 VLQVKHNSSLSPKPPQGTTIGFLFGSFFKARSFQNFKLIRSYS 442 >ref|XP_023923274.1| ACT domain-containing protein ACR6 [Quercus suber] gb|POE97090.1| act domain-containing protein acr6 [Quercus suber] Length = 443 Score = 66.6 bits (161), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NS SP PPQE T+ FLFGNLFKAR FQ+FKL+RSYS Sbjct: 401 VLKVKHNSCISPKPPQETTMGFLFGNLFKARNFQSFKLVRSYS 443 >gb|ABQ53997.1| unknown protein, partial [Cicer arietinum] Length = 106 Score = 62.0 bits (149), Expect = 9e-10 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NSS SP PPQ I FL G+ FKAR+FQNFKLIRSYS Sbjct: 64 VLQVKHNSSLSPKPPQGTKIGFLLGSFFKARSFQNFKLIRSYS 106 >ref|XP_021609576.1| ACT domain-containing protein ACR6 [Manihot esculenta] Length = 392 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 L V+ NS+ S PPQE T+ +LFGNLFKARTFQNFKLI+SYS Sbjct: 351 LQVKHNSTFSSKPPQETTMGYLFGNLFKARTFQNFKLIKSYS 392 >gb|OAY52498.1| hypothetical protein MANES_04G088400 [Manihot esculenta] Length = 424 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 L V+ NS+ S PPQE T+ +LFGNLFKARTFQNFKLI+SYS Sbjct: 383 LQVKHNSTFSSKPPQETTMGYLFGNLFKARTFQNFKLIKSYS 424 >gb|OVA17453.1| ACT domain [Macleaya cordata] Length = 443 Score = 65.1 bits (157), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V++NSS SP PP E T FLFGNLFKARTFQNF+LIRSYS Sbjct: 402 VLRVKRNSSLSPKPPPETT-GFLFGNLFKARTFQNFRLIRSYS 443 >gb|KHN02059.1| [Protein-PII] uridylyltransferase [Glycine soja] Length = 445 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NS+ SP PPQ TI FL GN FKAR+FQNFKLIRSYS Sbjct: 403 VLKVKHNSNLSPKPPQPTTIGFLLGNFFKARSFQNFKLIRSYS 445 >gb|ONI19979.1| hypothetical protein PRUPE_3G308800 [Prunus persica] Length = 358 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 +L VR+NSS P PQ T+ +LFGNLFKAR+FQNFKLIRSYS Sbjct: 316 ILQVRRNSSPPPKAPQGTTMGYLFGNLFKARSFQNFKLIRSYS 358 >gb|ONI19980.1| hypothetical protein PRUPE_3G308800 [Prunus persica] Length = 376 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 +L VR+NSS P PQ T+ +LFGNLFKAR+FQNFKLIRSYS Sbjct: 334 ILQVRRNSSPPPKAPQGTTMGYLFGNLFKARSFQNFKLIRSYS 376 >gb|ONI19977.1| hypothetical protein PRUPE_3G308800 [Prunus persica] Length = 382 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 +L VR+NSS P PQ T+ +LFGNLFKAR+FQNFKLIRSYS Sbjct: 340 ILQVRRNSSPPPKAPQGTTMGYLFGNLFKARSFQNFKLIRSYS 382 >ref|XP_015893954.1| PREDICTED: ACT domain-containing protein ACR6-like [Ziziphus jujuba] ref|XP_015865868.1| PREDICTED: ACT domain-containing protein ACR6-like [Ziziphus jujuba] Length = 443 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 6 LHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 L V+ +SS +P PPQE T+ FLFG FKARTFQNFKLIRSYS Sbjct: 402 LQVKYDSSLAPKPPQETTMGFLFGGFFKARTFQNFKLIRSYS 443 >ref|XP_007215389.1| ACT domain-containing protein ACR6 [Prunus persica] gb|ONI19976.1| hypothetical protein PRUPE_3G308800 [Prunus persica] Length = 443 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 +L VR+NSS P PQ T+ +LFGNLFKAR+FQNFKLIRSYS Sbjct: 401 ILQVRRNSSPPPKAPQGTTMGYLFGNLFKARSFQNFKLIRSYS 443 >gb|ONI19975.1| hypothetical protein PRUPE_3G308800 [Prunus persica] Length = 465 Score = 64.3 bits (155), Expect = 3e-09 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 +L VR+NSS P PQ T+ +LFGNLFKAR+FQNFKLIRSYS Sbjct: 423 ILQVRRNSSPPPKAPQGTTMGYLFGNLFKARSFQNFKLIRSYS 465 >gb|KRG94579.1| hypothetical protein GLYMA_19G095400 [Glycine max] Length = 360 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 3 VLHVRQNSSNSPNPPQEKTISFLFGNLFKARTFQNFKLIRSYS 131 VL V+ NS+ SP PPQ TI FL GN FKAR+FQNFKLI+SYS Sbjct: 318 VLKVKHNSNLSPKPPQPTTIGFLLGNFFKARSFQNFKLIKSYS 360