BLASTX nr result
ID: Acanthopanax21_contig00006703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00006703 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017231252.1| PREDICTED: protein WVD2-like 6 [Daucus carot... 57 2e-06 >ref|XP_017231252.1| PREDICTED: protein WVD2-like 6 [Daucus carota subsp. sativus] gb|KZN05380.1| hypothetical protein DCAR_006217 [Daucus carota subsp. sativus] Length = 419 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = +3 Query: 309 MMDTDNVIALSGNGKSGENGIREQLPVKWDEGISSEQVNGTLNDSSEIE 455 M DTD I + NG +GENG+ EQ+P KW E +S E+V+GT SS+IE Sbjct: 1 MTDTDIYIPAAENGPTGENGVHEQVPNKWKEEMSQEEVSGTTKSSSDIE 49