BLASTX nr result
ID: Acanthopanax21_contig00005894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00005894 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017237996.1| PREDICTED: zinc finger protein 346-like [Dau... 57 7e-07 >ref|XP_017237996.1| PREDICTED: zinc finger protein 346-like [Daucus carota subsp. sativus] gb|KZN02296.1| hypothetical protein DCAR_011050 [Daucus carota subsp. sativus] Length = 404 Score = 57.4 bits (137), Expect = 7e-07 Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 13/86 (15%) Frame = -3 Query: 293 DPY----KSTAGLNLPGVDV---------YSSLLQQPNGAAYAHYQTVSVESMAAPYYTD 153 DPY + ++ +N PG D+ Y +QQP G Y YQ VS E + APYY+D Sbjct: 62 DPYYNVSQGSSFVNPPGFDLNSYPPQSYGYDYQVQQPGGVDYQQYQAVSAEVVTAPYYSD 121 Query: 152 PNTGTTVNSWAVNEAVIPYLLGGTLP 75 PN + +WAVN+ V G TLP Sbjct: 122 PNAASMSTNWAVND-VTSAANGVTLP 146