BLASTX nr result
ID: Acanthopanax21_contig00005659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00005659 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021678210.1| uncharacterized protein LOC110663257 [Hevea ... 56 1e-06 >ref|XP_021678210.1| uncharacterized protein LOC110663257 [Hevea brasiliensis] Length = 171 Score = 56.2 bits (134), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 206 DDDGETAAVDFEKGMWDKLYGTGFWRNPSQK 298 DDDG+T AVD EK MWD+ Y TGFWR+PSQ+ Sbjct: 139 DDDGKTEAVDLEKEMWDRFYATGFWRSPSQR 169