BLASTX nr result
ID: Acanthopanax21_contig00005225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00005225 (573 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024007165.1| heavy metal-associated isoprenylated plant p... 77 4e-15 ref|XP_013594055.1| PREDICTED: nucleolar protein 58-like [Brassi... 77 4e-15 ref|XP_009150905.1| PREDICTED: glutamic acid-rich protein [Brass... 77 4e-15 gb|KFK27671.1| hypothetical protein AALP_AA8G413700 [Arabis alpina] 77 4e-15 gb|PPD78592.1| hypothetical protein GOBAR_DD24479 [Gossypium bar... 78 4e-15 gb|AFN53686.1| putative metal ion-binding protein [Linum usitati... 77 4e-15 ref|XP_021730090.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_021765127.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_021648261.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_024194850.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_021765126.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_021648252.1| heavy metal-associated isoprenylated plant p... 77 5e-15 ref|XP_004308088.1| PREDICTED: nucleolar protein 58 [Fragaria ve... 77 7e-15 ref|XP_010662763.1| PREDICTED: heavy metal-associated isoprenyla... 77 9e-15 emb|CAN70124.1| hypothetical protein VITISV_019514 [Vitis vinifera] 77 9e-15 ref|XP_002268244.1| PREDICTED: heavy metal-associated isoprenyla... 77 9e-15 ref|XP_020413429.1| heavy metal-associated isoprenylated plant p... 76 1e-14 ref|XP_020413428.1| heavy metal-associated isoprenylated plant p... 76 1e-14 ref|XP_023636966.1| heavy metal-associated isoprenylated plant p... 76 1e-14 ref|XP_018454552.1| PREDICTED: glutamic acid-rich protein-like [... 76 1e-14 >ref|XP_024007165.1| heavy metal-associated isoprenylated plant protein 39 [Eutrema salsugineum] Length = 103 Score = 77.4 bits (189), Expect = 4e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIGMMD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGMMDAVAVVKKLKKVGKVDLISVGPA 72 >ref|XP_013594055.1| PREDICTED: nucleolar protein 58-like [Brassica oleracea var. oleracea] ref|XP_013643482.2| heavy metal-associated isoprenylated plant protein 39 [Brassica napus] Length = 103 Score = 77.4 bits (189), Expect = 4e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIGMMD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGMMDAVAVVKKLKKVGKVDLISVGPA 72 >ref|XP_009150905.1| PREDICTED: glutamic acid-rich protein [Brassica rapa] ref|XP_022543369.1| heavy metal-associated isoprenylated plant protein 39-like [Brassica napus] Length = 103 Score = 77.4 bits (189), Expect = 4e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIGMMD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGMMDAVAVVKKLKKVGKVDLISVGPA 72 >gb|KFK27671.1| hypothetical protein AALP_AA8G413700 [Arabis alpina] Length = 103 Score = 77.4 bits (189), Expect = 4e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIGMMD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGMMDTVAVVKKLKKVGKVDLISVGPA 72 >gb|PPD78592.1| hypothetical protein GOBAR_DD24479 [Gossypium barbadense] Length = 121 Score = 77.8 bits (190), Expect = 4e-15 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = -1 Query: 465 IVMPGVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 IV+ GVDSIAADLK+QK+TVIG MD+VAVVKK+K+VGKVD++SVGPA Sbjct: 46 IVVAGVDSIAADLKDQKLTVIGQMDAVAVVKKLKKVGKVDLVSVGPA 92 >gb|AFN53686.1| putative metal ion-binding protein [Linum usitatissimum] Length = 95 Score = 77.0 bits (188), Expect = 4e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD+VAVVKK+K+VGKVDI+SVGPA Sbjct: 31 GVDSIAADLKEQKLTVIGLMDTVAVVKKLKKVGKVDILSVGPA 73 >ref|XP_021730090.1| heavy metal-associated isoprenylated plant protein 39-like [Chenopodium quinoa] Length = 101 Score = 77.0 bits (188), Expect = 5e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADLKEQKLTVIGLMDAVAVVKKLKKVGKVDLISVGPA 72 >ref|XP_021765127.1| heavy metal-associated isoprenylated plant protein 39-like isoform X2 [Chenopodium quinoa] Length = 101 Score = 77.0 bits (188), Expect = 5e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADLKEQKLTVIGLMDAVAVVKKLKKVGKVDLISVGPA 72 >ref|XP_021648261.1| heavy metal-associated isoprenylated plant protein 39-like isoform X2 [Hevea brasiliensis] Length = 101 Score = 77.0 bits (188), Expect = 5e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD VAVVKK+K+VGKVDIISVGPA Sbjct: 30 GVDSIAADLKEQKLTVIGLMDPVAVVKKLKKVGKVDIISVGPA 72 >ref|XP_024194850.1| heavy metal-associated isoprenylated plant protein 39 [Rosa chinensis] gb|PRQ60093.1| putative heavy metal-associated domain, HMA [Rosa chinensis] Length = 102 Score = 77.0 bits (188), Expect = 5e-15 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 G+DSIAADLK+QK+TV+GMMD+VAVVKK+K+VGKVDIISVGPA Sbjct: 30 GIDSIAADLKDQKLTVVGMMDTVAVVKKLKKVGKVDIISVGPA 72 >ref|XP_021765126.1| heavy metal-associated isoprenylated plant protein 39-like isoform X1 [Chenopodium quinoa] Length = 102 Score = 77.0 bits (188), Expect = 5e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 31 GVDSIAADLKEQKLTVIGLMDAVAVVKKLKKVGKVDLISVGPA 73 >ref|XP_021648252.1| heavy metal-associated isoprenylated plant protein 39-like isoform X1 [Hevea brasiliensis] Length = 102 Score = 77.0 bits (188), Expect = 5e-15 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAADLKEQK+TVIG+MD VAVVKK+K+VGKVDIISVGPA Sbjct: 31 GVDSIAADLKEQKLTVIGLMDPVAVVKKLKKVGKVDIISVGPA 73 >ref|XP_004308088.1| PREDICTED: nucleolar protein 58 [Fragaria vesca subsp. vesca] Length = 102 Score = 76.6 bits (187), Expect = 7e-15 Identities = 35/43 (81%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 G+DSIAADLK+QK+TV+GMMD+VAVVKK+K+VGKVDI+SVGPA Sbjct: 30 GIDSIAADLKDQKLTVVGMMDTVAVVKKLKKVGKVDIVSVGPA 72 >ref|XP_010662763.1| PREDICTED: heavy metal-associated isoprenylated plant protein 39 isoform X2 [Vitis vinifera] Length = 109 Score = 76.6 bits (187), Expect = 9e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIG+MD+VAVVKK+K+VGKVDIISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGVMDAVAVVKKLKKVGKVDIISVGPA 72 >emb|CAN70124.1| hypothetical protein VITISV_019514 [Vitis vinifera] Length = 110 Score = 76.6 bits (187), Expect = 9e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIG+MD+VAVVKK+K+VGKVDIISVGPA Sbjct: 31 GVDSIAADMKEQKLTVIGVMDTVAVVKKLKKVGKVDIISVGPA 73 >ref|XP_002268244.1| PREDICTED: heavy metal-associated isoprenylated plant protein 39 isoform X1 [Vitis vinifera] emb|CBI22747.3| unnamed protein product, partial [Vitis vinifera] Length = 110 Score = 76.6 bits (187), Expect = 9e-15 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIG+MD+VAVVKK+K+VGKVDIISVGPA Sbjct: 31 GVDSIAADMKEQKLTVIGVMDAVAVVKKLKKVGKVDIISVGPA 73 >ref|XP_020413429.1| heavy metal-associated isoprenylated plant protein 39 isoform X2 [Prunus persica] ref|XP_021826940.1| heavy metal-associated isoprenylated plant protein 39 isoform X2 [Prunus avium] gb|ONI25300.1| hypothetical protein PRUPE_2G294600 [Prunus persica] Length = 101 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 G+DSIAADLK+QK+TV+GMMD VAVVKK+K+VGKVDIISVGPA Sbjct: 30 GIDSIAADLKDQKLTVVGMMDPVAVVKKLKKVGKVDIISVGPA 72 >ref|XP_020413428.1| heavy metal-associated isoprenylated plant protein 39 isoform X1 [Prunus persica] ref|XP_021826938.1| heavy metal-associated isoprenylated plant protein 39 isoform X1 [Prunus avium] gb|ONI25301.1| hypothetical protein PRUPE_2G294600 [Prunus persica] Length = 102 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 G+DSIAADLK+QK+TV+GMMD VAVVKK+K+VGKVDIISVGPA Sbjct: 31 GIDSIAADLKDQKLTVVGMMDPVAVVKKLKKVGKVDIISVGPA 73 >ref|XP_023636966.1| heavy metal-associated isoprenylated plant protein 39 [Capsella rubella] Length = 103 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIG+MD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGLMDAVAVVKKLKKVGKVDLISVGPA 72 >ref|XP_018454552.1| PREDICTED: glutamic acid-rich protein-like [Raphanus sativus] Length = 103 Score = 76.3 bits (186), Expect = 1e-14 Identities = 36/43 (83%), Positives = 43/43 (100%) Frame = -1 Query: 453 GVDSIAADLKEQKITVIGMMDSVAVVKKMKRVGKVDIISVGPA 325 GVDSIAAD+KEQK+TVIG+MD+VAVVKK+K+VGKVD+ISVGPA Sbjct: 30 GVDSIAADMKEQKLTVIGLMDAVAVVKKLKKVGKVDLISVGPA 72