BLASTX nr result
ID: Acanthopanax21_contig00004942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004942 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291806.1| orf36 (mitochondrion) [Daucus carota subsp. ... 84 1e-17 >ref|YP_006291806.1| orf36 (mitochondrion) [Daucus carota subsp. sativus] gb|AEY81174.1| orf36 (mitochondrion) [Daucus carota subsp. sativus] Length = 155 Score = 83.6 bits (205), Expect = 1e-17 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = +1 Query: 244 DGFRRSNENSFLPFLPLWLDYSACLTQVLFNLHGPLHYPASSGSKAT 384 D NE+SFL FLP+WLDYSACLTQVLFNLHGPLHYPAS GSKAT Sbjct: 108 DALIEENEDSFLLFLPIWLDYSACLTQVLFNLHGPLHYPASVGSKAT 154