BLASTX nr result
ID: Acanthopanax21_contig00004937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004937 (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF27140.1| conserved hypothetical protein [Ricinus communis] 89 5e-17 >gb|EEF27140.1| conserved hypothetical protein [Ricinus communis] Length = 235 Score = 88.6 bits (218), Expect = 5e-17 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 RAAWQADILLVIYPMGYLLAATTGVHQPAESTYPLTSHFGN 123 RAAWQADILLVIYPMGYLLAATTGVHQPAESTYPLTSHFGN Sbjct: 194 RAAWQADILLVIYPMGYLLAATTGVHQPAESTYPLTSHFGN 234