BLASTX nr result
ID: Acanthopanax21_contig00004861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004861 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00520.1| unnamed protein product [Coffea canephora] 98 2e-20 gb|KZV18629.1| protein NSP-INTERACTING KINASE 1 [Dorcoceras hygr... 97 5e-20 ref|XP_015075652.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 97 5e-20 ref|XP_022888302.1| protein NSP-INTERACTING KINASE 2-like [Olea ... 97 5e-20 ref|XP_015075651.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 97 5e-20 ref|XP_015164779.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 97 5e-20 ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 97 5e-20 gb|PHT33508.1| Protein NSP-INTERACTING KINASE 3 [Capsicum baccatum] 97 5e-20 gb|PHU02171.1| Protein NSP-INTERACTING KINASE 1 [Capsicum chinense] 97 5e-20 ref|XP_016548068.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 97 5e-20 ref|XP_011070875.1| protein NSP-INTERACTING KINASE 2-like [Sesam... 96 6e-20 emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] 96 1e-19 ref|XP_017226559.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 96 1e-19 ref|XP_015894250.1| PREDICTED: protein NSP-INTERACTING KINASE 2 ... 96 1e-19 ref|XP_019234274.1| PREDICTED: protein NSP-INTERACTING KINASE 2-... 96 1e-19 ref|XP_016499009.1| PREDICTED: protein NSP-INTERACTING KINASE 2-... 96 1e-19 ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-... 96 1e-19 ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-... 96 1e-19 ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 96 1e-19 dbj|GAV66917.1| LRRNT_2 domain-containing protein, partial [Ceph... 90 1e-19 >emb|CDP00520.1| unnamed protein product [Coffea canephora] Length = 623 Score = 97.8 bits (242), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAEATRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 575 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 623 >gb|KZV18629.1| protein NSP-INTERACTING KINASE 1 [Dorcoceras hygrometricum] Length = 585 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQ+AEATRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 537 DGLAEKWEASQKAEATRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 585 >ref|XP_015075652.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Solanum pennellii] ref|XP_015075653.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Solanum pennellii] Length = 586 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 538 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 586 >ref|XP_022888302.1| protein NSP-INTERACTING KINASE 2-like [Olea europaea var. sylvestris] Length = 621 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 573 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 621 >ref|XP_015075651.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Solanum pennellii] Length = 621 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 573 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 621 >ref|XP_015164779.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum] Length = 621 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 573 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 621 >ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum] Length = 621 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 573 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 621 >gb|PHT33508.1| Protein NSP-INTERACTING KINASE 3 [Capsicum baccatum] Length = 626 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 578 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 626 >gb|PHU02171.1| Protein NSP-INTERACTING KINASE 1 [Capsicum chinense] Length = 627 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 579 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 627 >ref|XP_016548068.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Capsicum annuum] gb|PHT67447.1| Protein NSP-INTERACTING KINASE 1 [Capsicum annuum] Length = 627 Score = 96.7 bits (239), Expect = 5e-20 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 579 DGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 627 >ref|XP_011070875.1| protein NSP-INTERACTING KINASE 2-like [Sesamum indicum] Length = 623 Score = 96.3 bits (238), Expect = 6e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 575 DGLAEKWEASQRAEVTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 623 >emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] Length = 609 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEA+QRAEATRC+ANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 561 DGLAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 609 >ref|XP_017226559.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Daucus carota subsp. sativus] gb|KZM82568.1| hypothetical protein DCAR_030137 [Daucus carota subsp. sativus] Length = 623 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEA+QRAEATRCRANEFSSSERYSDLT+DSS+LVQAMELSGPR Sbjct: 575 DGLAEKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAMELSGPR 623 >ref|XP_015894250.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Ziziphus jujuba] Length = 623 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQRAE+TRCRAN+FSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 575 DGLAEKWEASQRAESTRCRANDFSSSERYSDLTDDSSLLVQAMELSGPR 623 >ref|XP_019234274.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana attenuata] gb|OIT26843.1| protein nsp-interacting kinase 2 [Nicotiana attenuata] Length = 624 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQ+AE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 576 DGLAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 624 >ref|XP_016499009.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tabacum] Length = 624 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQ+AE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 576 DGLAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 624 >ref|XP_009765506.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana sylvestris] ref|XP_016480346.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tabacum] Length = 624 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQ+AE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 576 DGLAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 624 >ref|XP_009625494.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Nicotiana tomentosiformis] Length = 624 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEASQ+AE+TRCRANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 576 DGLAEKWEASQKAESTRCRANEFSSSERYSDLTDDSSLLVQAMELSGPR 624 >ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera] emb|CBI27432.3| unnamed protein product, partial [Vitis vinifera] Length = 625 Score = 95.5 bits (236), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEA+QRAEATRC+ANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 577 DGLAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAMELSGPR 625 >dbj|GAV66917.1| LRRNT_2 domain-containing protein, partial [Cephalotus follicularis] Length = 168 Score = 90.1 bits (222), Expect = 1e-19 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -2 Query: 517 DGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAMELSGPR 371 DGLAEKWEA+QRAEA R RANEFSSSERYSDLT+DSSLLVQAMELSGPR Sbjct: 120 DGLAEKWEATQRAEAIRYRANEFSSSERYSDLTDDSSLLVQAMELSGPR 168