BLASTX nr result
ID: Acanthopanax21_contig00004242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004242 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN06103.1| hypothetical protein DCAR_006940 [Daucus carota s... 61 5e-08 ref|XP_017231791.1| PREDICTED: calmodulin-binding receptor-like ... 61 6e-08 gb|POE67573.1| calmodulin-binding receptor-like cytoplasmic kina... 54 6e-07 gb|OMO78794.1| hypothetical protein CCACVL1_14100 [Corchorus cap... 57 9e-07 ref|XP_018811510.1| PREDICTED: calmodulin-binding receptor-like ... 56 2e-06 ref|XP_018835183.1| PREDICTED: calmodulin-binding receptor-like ... 55 4e-06 >gb|KZN06103.1| hypothetical protein DCAR_006940 [Daucus carota subsp. sativus] Length = 359 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLNSQRSISEIEQ 308 +NRPRMRRCAEILW+IRKDYT L+ N +LS NSQRS S E+ Sbjct: 316 RNRPRMRRCAEILWNIRKDYTELLGLNTPSLSSNSQRSHSISEE 359 >ref|XP_017231791.1| PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 2 [Daucus carota subsp. sativus] Length = 433 Score = 60.8 bits (146), Expect = 6e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLNSQRSISEIEQ 308 +NRPRMRRCAEILW+IRKDYT L+ N +LS NSQRS S E+ Sbjct: 390 RNRPRMRRCAEILWNIRKDYTELLGLNTPSLSSNSQRSHSISEE 433 >gb|POE67573.1| calmodulin-binding receptor-like cytoplasmic kinase 2 [Quercus suber] Length = 86 Score = 54.3 bits (129), Expect = 6e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLNSQRSISEIEQ 308 +NRP MRRCAEILWSIRKDY + A ++ +LS +S RS S EQ Sbjct: 43 QNRPSMRRCAEILWSIRKDYREVSASDVRSLSSHSMRSTSIREQ 86 >gb|OMO78794.1| hypothetical protein CCACVL1_14100 [Corchorus capsularis] Length = 438 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLNSQRSISEIEQ 308 ++RP MRRC E+LWSIRKDY + A ++H+LS NSQRS S EQ Sbjct: 395 QSRPSMRRCGEVLWSIRKDYREVSALDLHSLSSNSQRSASVREQ 438 >ref|XP_018811510.1| PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 2 [Juglans regia] Length = 438 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLNSQRSISEIE 311 +NRP MRRCAEILW IRKDY L A + H+LS +SQR+ S E Sbjct: 395 QNRPSMRRCAEILWGIRKDYRELTALDCHSLSSHSQRNASRRE 437 >ref|XP_018835183.1| PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 2 [Juglans regia] Length = 443 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -2 Query: 439 KNRPRMRRCAEILWSIRKDYTGLVA*NIHALSLN--SQRSIS 320 +NRPRMR CAEILWSIRKDY L A + H+LSL+ S+RS+S Sbjct: 399 QNRPRMRMCAEILWSIRKDYRELSASDFHSLSLSDRSERSVS 440