BLASTX nr result
ID: Acanthopanax21_contig00004230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004230 (1059 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM86114.1| hypothetical protein DCAR_026464 [Daucus carota s... 71 2e-10 ref|XP_017226808.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 71 2e-10 ref|XP_017226807.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 71 2e-10 dbj|GAV57436.1| UbiA domain-containing protein [Cephalotus folli... 70 4e-10 ref|XP_017226803.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 71 6e-10 ref|XP_017222930.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 71 6e-10 emb|CBI27131.3| unnamed protein product, partial [Vitis vinifera] 70 9e-10 ref|XP_002279483.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 70 1e-09 ref|XP_010648357.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 70 1e-09 ref|XP_019057351.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 2e-09 ref|XP_010541312.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 3e-09 ref|XP_019057327.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 3e-09 ref|XP_019106429.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 3e-09 ref|XP_022867205.1| 4-hydroxybenzoate polyprenyltransferase, mit... 64 3e-09 ref|XP_010684755.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 69 3e-09 gb|KVH89809.1| hypothetical protein Ccrd_008219 [Cynara carduncu... 69 4e-09 gb|ONI14332.1| hypothetical protein PRUPE_4G276200 [Prunus persica] 68 6e-09 ref|XP_008221043.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 68 6e-09 ref|XP_016647266.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 68 6e-09 ref|XP_008227533.1| PREDICTED: 4-hydroxybenzoate polyprenyltrans... 68 6e-09 >gb|KZM86114.1| hypothetical protein DCAR_026464 [Daucus carota subsp. sativus] Length = 244 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAIRGSLDP IVFPLYLSGVCWTLVYDTIYAHQ Sbjct: 112 AAIRGSLDPTIVFPLYLSGVCWTLVYDTIYAHQ 144 >ref|XP_017226808.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X3 [Daucus carota subsp. sativus] gb|KZM82090.1| hypothetical protein DCAR_029703 [Daucus carota subsp. sativus] Length = 244 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAIRGSLDP IVFPLYLSGVCWTLVYDTIYAHQ Sbjct: 112 AAIRGSLDPTIVFPLYLSGVCWTLVYDTIYAHQ 144 >ref|XP_017226807.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X2 [Daucus carota subsp. sativus] Length = 264 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAIRGSLDP IVFPLYLSGVCWTLVYDTIYAHQ Sbjct: 132 AAIRGSLDPTIVFPLYLSGVCWTLVYDTIYAHQ 164 >dbj|GAV57436.1| UbiA domain-containing protein [Cephalotus follicularis] Length = 261 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAI+GSLDPA+VFPLY+SGVCWTLVYDTIYAHQ Sbjct: 129 AAIKGSLDPAVVFPLYISGVCWTLVYDTIYAHQ 161 >ref|XP_017226803.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] ref|XP_017226804.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] ref|XP_017226806.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X1 [Daucus carota subsp. sativus] Length = 402 Score = 71.2 bits (173), Expect = 6e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAIRGSLDP IVFPLYLSGVCWTLVYDTIYAHQ Sbjct: 270 AAIRGSLDPTIVFPLYLSGVCWTLVYDTIYAHQ 302 >ref|XP_017222930.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Daucus carota subsp. sativus] Length = 402 Score = 71.2 bits (173), Expect = 6e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AAIRGSLDP IVFPLYLSGVCWTLVYDTIYAHQ Sbjct: 270 AAIRGSLDPTIVFPLYLSGVCWTLVYDTIYAHQ 302 >emb|CBI27131.3| unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 70.5 bits (171), Expect = 9e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +A+RGSLDPAIVFPLY+SGVCWTLVYDTIYAHQ Sbjct: 239 SAVRGSLDPAIVFPLYISGVCWTLVYDTIYAHQ 271 >ref|XP_002279483.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X2 [Vitis vinifera] Length = 412 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +A+RGSLDPAIVFPLY+SGVCWTLVYDTIYAHQ Sbjct: 280 SAVRGSLDPAIVFPLYISGVCWTLVYDTIYAHQ 312 >ref|XP_010648357.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Vitis vinifera] ref|XP_010648361.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Vitis vinifera] Length = 413 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +A+RGSLDPAIVFPLY+SGVCWTLVYDTIYAHQ Sbjct: 280 SAVRGSLDPAIVFPLYISGVCWTLVYDTIYAHQ 312 >ref|XP_019057351.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X3 [Tarenaya hassleriana] Length = 368 Score = 69.3 bits (168), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GSL+PA+VFPLYLSGVCWTLVYDTIYAHQ Sbjct: 333 AAVKGSLEPAVVFPLYLSGVCWTLVYDTIYAHQ 365 >ref|XP_010541312.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Tarenaya hassleriana] ref|XP_010541318.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Tarenaya hassleriana] ref|XP_010541328.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Tarenaya hassleriana] ref|XP_019057338.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Tarenaya hassleriana] Length = 402 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GSL+PA+VFPLYLSGVCWTLVYDTIYAHQ Sbjct: 270 AAVKGSLEPAVVFPLYLSGVCWTLVYDTIYAHQ 302 >ref|XP_019057327.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 417 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GSL+PA+VFPLYLSGVCWTLVYDTIYAHQ Sbjct: 285 AAVKGSLEPAVVFPLYLSGVCWTLVYDTIYAHQ 317 >ref|XP_019106429.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] Length = 377 Score = 68.9 bits (167), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +A+RGSLDP I+FPLYLSGVCWTLVYDTIYAHQ Sbjct: 266 SAVRGSLDPLIIFPLYLSGVCWTLVYDTIYAHQ 298 >ref|XP_022867205.1| 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like, partial [Olea europaea var. sylvestris] Length = 96 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA+RGSLDPAIV PLY SGV WTLVYDTIYAHQ Sbjct: 19 AAVRGSLDPAIVLPLYASGVFWTLVYDTIYAHQ 51 >ref|XP_010684755.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial isoform X1 [Beta vulgaris subsp. vulgaris] gb|KMT05818.1| hypothetical protein BVRB_7g165920 [Beta vulgaris subsp. vulgaris] Length = 398 Score = 68.9 bits (167), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +A+RGSLDP I+FPLYLSGVCWTLVYDTIYAHQ Sbjct: 266 SAVRGSLDPLIIFPLYLSGVCWTLVYDTIYAHQ 298 >gb|KVH89809.1| hypothetical protein Ccrd_008219 [Cynara cardunculus var. scolymus] Length = 438 Score = 68.9 bits (167), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 +AIRGSLDPA+V PLYLSGVCWTLVYDTIYAHQ Sbjct: 276 SAIRGSLDPAVVLPLYLSGVCWTLVYDTIYAHQ 308 >gb|ONI14332.1| hypothetical protein PRUPE_4G276200 [Prunus persica] Length = 392 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GS+DPAIV PLYLSGVCWTLVYDTIYAHQ Sbjct: 269 AAVKGSIDPAIVLPLYLSGVCWTLVYDTIYAHQ 301 >ref|XP_008221043.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X4 [Prunus mume] Length = 393 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GS+DPAIV PLYLSGVCWTLVYDTIYAHQ Sbjct: 261 AAVKGSIDPAIVLPLYLSGVCWTLVYDTIYAHQ 293 >ref|XP_016647266.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like isoform X3 [Prunus mume] Length = 398 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GS+DPAIV PLYLSGVCWTLVYDTIYAHQ Sbjct: 266 AAVKGSIDPAIVLPLYLSGVCWTLVYDTIYAHQ 298 >ref|XP_008227533.1| PREDICTED: 4-hydroxybenzoate polyprenyltransferase, mitochondrial-like [Prunus mume] Length = 399 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 312 AAIRGSLDPAIVFPLYLSGVCWTLVYDTIYAHQ 410 AA++GS+DPAIV PLYLSGVCWTLVYDTIYAHQ Sbjct: 267 AAVKGSIDPAIVLPLYLSGVCWTLVYDTIYAHQ 299