BLASTX nr result
ID: Acanthopanax21_contig00004056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004056 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB77144.1| hypothetical protein L484_002032 [Morus notabilis] 74 3e-13 >gb|EXB77144.1| hypothetical protein L484_002032 [Morus notabilis] Length = 134 Score = 73.9 bits (180), Expect = 3e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +2 Query: 8 MLWVGNLCSSLLHFRCLRSSSCPSVLQSWSTPAV 109 MLWVGNLCSSLLHFRCLRSSSCPSV QSWSTPAV Sbjct: 1 MLWVGNLCSSLLHFRCLRSSSCPSVSQSWSTPAV 34