BLASTX nr result
ID: Acanthopanax21_contig00004026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00004026 (885 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS08355.1| hypothetical protein GOBAR_AA12284 [Gossypium bar... 87 3e-15 >gb|PPS08355.1| hypothetical protein GOBAR_AA12284 [Gossypium barbadense] Length = 555 Score = 86.7 bits (213), Expect = 3e-15 Identities = 51/102 (50%), Positives = 59/102 (57%) Frame = +3 Query: 3 PLWKLGDQXXXXXXXXXXXXERKCAFMVYGNSSPLRDRLGHDGYDILLGVLPHYRKRTTG 182 PLWKL DQ +RKCAF+VY NSSPLR RLGHD YDILLGVLPHYR T Sbjct: 457 PLWKLSDQSSLASKAVYSVSKRKCAFLVYCNSSPLRGRLGHDVYDILLGVLPHYRDPT-- 514 Query: 183 IRRRFLSWKRCLEISRPSAKKLVPW*DRWMKPILLDSKPNGD 308 + + ++ R +V D + ILLDSKPNGD Sbjct: 515 LLLVLGKMPQNFKVKREETCSMVGLMDEAI-TILLDSKPNGD 555