BLASTX nr result
ID: Acanthopanax21_contig00003993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003993 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU19234.1| hypothetical protein TSUD_199160, partial [Trifo... 83 1e-17 ref|YP_009381683.1| hypothetical protein AEK19_MT1267 (mitochond... 44 3e-07 >dbj|GAU19234.1| hypothetical protein TSUD_199160, partial [Trifolium subterraneum] Length = 88 Score = 82.8 bits (203), Expect = 1e-17 Identities = 42/50 (84%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = -3 Query: 421 LFPLRGELGLTTHSYDRSSILTFDGNKERLQRSHQGLPSDRGRHF-KRGF 275 L P +GELGLTTHS DRSSILT GNKERLQRSHQGLPSDRGRHF RGF Sbjct: 37 LRPSKGELGLTTHSVDRSSILTLGGNKERLQRSHQGLPSDRGRHFYLRGF 86 >ref|YP_009381683.1| hypothetical protein AEK19_MT1267 (mitochondrion) [Utricularia reniformis] gb|ART31474.1| hypothetical protein AEK19_MT1267 (mitochondrion) [Utricularia reniformis] Length = 64 Score = 43.9 bits (102), Expect(2) = 3e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -3 Query: 283 RGFTICSFAFSRLLTALQNEVHINKG 206 RG TICSFA SRLLT+LQN VH+ KG Sbjct: 38 RGLTICSFALSRLLTSLQNSVHMFKG 63 Score = 38.5 bits (88), Expect(2) = 3e-07 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 357 LSTGTRNDCSDHTKVFRRIGAG 292 +++ RN CSDHTKVFRRIGAG Sbjct: 16 INSQRRNGCSDHTKVFRRIGAG 37