BLASTX nr result
ID: Acanthopanax21_contig00003936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003936 (1107 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024171992.1| uncharacterized protein LOC112177999 [Rosa c... 42 1e-06 >ref|XP_024171992.1| uncharacterized protein LOC112177999 [Rosa chinensis] Length = 226 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 15/27 (55%), Positives = 24/27 (88%) Frame = +3 Query: 123 DGIEDVIDERVVSTRRGEYHQYLVKWE 203 D +E+++DE+VVSTR+G Y +YL+KW+ Sbjct: 163 DVVENIVDEQVVSTRQGGYQKYLIKWK 189 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +2 Query: 203 DKPHSDCTLISREEFHRIDPTLLERYDSFLS 295 D+P+SD T +++EE RIDP + ERY SF+S Sbjct: 190 DRPNSDNTWVTKEELQRIDPDIRERYYSFIS 220