BLASTX nr result
ID: Acanthopanax21_contig00003927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00003927 (583 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019080132.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_017242085.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 gb|KZN03141.1| hypothetical protein DCAR_011897 [Daucus carota s... 57 5e-06 ref|XP_017242068.1| PREDICTED: putative pentatricopeptide repeat... 57 5e-06 >ref|XP_019080132.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 [Vitis vinifera] Length = 666 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 2 QHPQKDEIYVQLEVLRKNIKAMGYVPDLRYALQPED 109 QHPQK EIYV+LE LR+ IKAMGYVPDLRY L D Sbjct: 631 QHPQKKEIYVKLEELREKIKAMGYVPDLRYVLNNAD 666 >ref|XP_017242085.1| PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like isoform X2 [Daucus carota subsp. sativus] Length = 719 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 5 HPQKDEIYVQLEVLRKNIKAMGYVPDLRYALQ 100 HPQKD+IYVQLEVL K IK MGYVP LRYALQ Sbjct: 687 HPQKDDIYVQLEVLSKGIKDMGYVPCLRYALQ 718 >gb|KZN03141.1| hypothetical protein DCAR_011897 [Daucus carota subsp. sativus] Length = 751 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 5 HPQKDEIYVQLEVLRKNIKAMGYVPDLRYALQ 100 HPQKD+IYVQLEVL K IK MGYVP LRYALQ Sbjct: 719 HPQKDDIYVQLEVLSKGIKDMGYVPCLRYALQ 750 >ref|XP_017242068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242069.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242070.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242071.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242072.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242074.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242075.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242076.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242077.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242078.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242079.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242080.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242081.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242082.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242083.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] ref|XP_017242084.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 isoform X1 [Daucus carota subsp. sativus] Length = 765 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 5 HPQKDEIYVQLEVLRKNIKAMGYVPDLRYALQ 100 HPQKD+IYVQLEVL K IK MGYVP LRYALQ Sbjct: 733 HPQKDDIYVQLEVLSKGIKDMGYVPCLRYALQ 764